Lus10025868 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038232 139 / 7e-44 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10025868 pacid=23177600 polypeptide=Lus10025868 locus=Lus10025868.g ID=Lus10025868.BGIv1.0 annot-version=v1.0
ATGGCAACTACTCAGGCTGAGGCAGGGCAAGCAGAGAAGTCAATTCAGAAAGTGGCGTCGGATGATCATCCTCAAGAAGAGAAGCAATCAGAAGTGGTGG
TGGATGAAGAAGAAAATGGTATGAAACAACAAGTGAAGGGGAAAAGCCAGGAGGAGAGTCAAGAAGAGGATGAGGATGAGATGTGGCCGCCGGCTGAACA
CCATTTGCCTGCTGCAGTTTCCGGTGAAGACGTTGACGGGCCTGAAGGGGGAACGGCCGCTGTTCCTTCGTTCGATGACGAAGAAGACGAGGACGACGAT
GGCAAAGATGACGAAGAAGATGAAGAGGACATGTGA
AA sequence
>Lus10025868 pacid=23177600 polypeptide=Lus10025868 locus=Lus10025868.g ID=Lus10025868.BGIv1.0 annot-version=v1.0
MATTQAEAGQAEKSIQKVASDDHPQEEKQSEVVVDEEENGMKQQVKGKSQEESQEEDEDEMWPPAEHHLPAAVSGEDVDGPEGGTAAVPSFDDEEDEDDD
GKDDEEDEEDM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025868 0 1
Lus10038232 1.0 0.9829
Lus10032860 2.0 0.9786
AT1G76430 PHT1;9 phosphate transporter 1;9 (.1) Lus10025163 2.6 0.9494
AT1G31335 unknown protein Lus10040642 2.8 0.9494
AT1G69880 ATH8 thioredoxin H-type 8 (.1) Lus10037225 3.2 0.9606
AT1G23530 unknown protein Lus10030608 3.9 0.9659
AT2G36650 unknown protein Lus10014389 4.0 0.9635
AT1G07400 HSP20-like chaperones superfam... Lus10021503 4.1 0.9414
AT4G05430 Carbohydrate-binding X8 domain... Lus10023276 4.9 0.9440
Lus10010378 6.0 0.9522

Lus10025868 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.