Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038229 [exp] 95 / 9e-27 AT3G07425 52 / 3e-10 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G250100 [exp] 38 / 0.0001 AT3G07425 49 / 6e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025871 pacid=23177601 polypeptide=Lus10025871 locus=Lus10025871.g ID=Lus10025871.BGIv1.0 annot-version=v1.0 ATGGTGCCAAGCTCCAATTCGCTAGTGAGATGGTGCCAGCCGCAGCGGCGGTCAATGAGGCGGCGGAGGGGTAGCACCATAAAGCTGGGGAGCCGACGAC GGCGTGGGTTCTTCCTGGGGACCAGGCGGACGGTTCGATGGGGTCTGGTGGTGGCGGCTCCTCTAAGAATGCTCAAGAAAATGATGATGAAATTAGCTTC TCCAGCTACTAGTACTGGTACTGCTGCTGCTGGTTACGCTGATTTGGAGGCTTACTATCGTAATTTTCCATTTTTACGTCCTCAGATATTTCCCCTTTGT TGA
AA sequence Show only first row Show all	>Lus10025871 pacid=23177601 polypeptide=Lus10025871 locus=Lus10025871.g ID=Lus10025871.BGIv1.0 annot-version=v1.0 MVPSSNSLVRWCQPQRRSMRRRRGSTIKLGSRRRRGFFLGTRRTVRWGLVVAAPLRMLKKMMMKLASPATSTGTAAAGYADLEAYYRNFPFLRPQIFPLC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07425			unknown protein		Lus10025871 [exp]	0	1
AT2G35120			Single hybrid motif superfamil...		Lus10018319 [exp]	11.8	0.7770
AT2G32720		B5 #4, B5#4, AT...	ARABIDOPSIS CYTOCHROME B5 ISOF...		Lus10011858 [exp]	15.0	0.7753
AT3G10120			unknown protein		Lus10021358 [exp]	16.2	0.7433
AT1G24350			Acid phosphatase/vanadium-depe...		Lus10036984 [exp]	19.9	0.7436
AT5G13420			Aldolase-type TIM barrel famil...		Lus10043136 [exp]	23.4	0.7611
AT3G53720		ATCHX20	cation/H+ exchanger 20, cation...		Lus10025324 [exp]	29.7	0.7359
AT2G45290			Transketolase (.1)		Lus10000789 [exp]	30.1	0.7493
AT2G19570		DESZ, AT-CDA1, ...	cytidine deaminase 1 (.1)		Lus10007654 [exp]	35.2	0.7365
AT5G01750			Protein of unknown function (D...		Lus10001255 [exp]	36.0	0.7330
AT4G12410			SAUR-like auxin-responsive pro...		Lus10004337 [exp]	36.3	0.6461

Compare expression of checked genes

Lus10025871 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.