Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07410 325 / 2e-114 AtRABA5b RAB GTPase homolog A5B (.1) AT2G43130 322 / 5e-113 ARA4, AtRab11F, AtRABA5c, Ara-4 ARABIDOPSIS RAB GTPASE HOMOLOG A5C, P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT1G05810 319 / 3e-111 ARA, Ara-1, AtRab11D, AtRABA5e ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) AT2G31680 311 / 8e-109 AtRABA5d RAB GTPase homolog A5D (.1) AT5G47520 268 / 2e-91 AtRABA5a RAB GTPase homolog A5A (.1) AT4G18430 233 / 1e-77 AtRABA1e RAB GTPase homolog A1E (.1) AT1G07410 231 / 2e-77 ATRAB-A2B, AtRABA2b ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) AT3G12160 231 / 5e-77 AtRABA4d ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) AT5G47960 230 / 2e-76 SMG1, AtRABA4c SMALL MOLECULAR WEIGHT G-PROTEIN 1, RAB GTPase homolog A4C (.1) AT4G39990 229 / 3e-76 ATGB3, AtRABA4b, AtRab11G ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A 4B, GTP-BINDING PROTEIN 3, RAB GTPase homolog A4B (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038226 [exp] 412 / 1e-148 AT1G05810 333 / 3e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Lus10026731 [exp] 325 / 3e-114 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10025516 [exp] 325 / 3e-114 AT2G31680 381 / 2e-136 RAB GTPase homolog A5D (.1) Lus10038807 [exp] 261 / 6e-89 AT5G47520 376 / 2e-134 RAB GTPase homolog A5A (.1) Lus10000536 [exp] 255 / 2e-86 AT5G47520 369 / 3e-131 RAB GTPase homolog A5A (.1) Lus10017558 [exp] 254 / 4e-86 AT5G47520 367 / 1e-130 RAB GTPase homolog A5A (.1) Lus10023153 [exp] 233 / 1e-77 AT5G65270 396 / 3e-142 RAB GTPase homolog A4A (.1) Lus10035924 [exp] 232 / 3e-77 AT5G65270 404 / 3e-145 RAB GTPase homolog A4A (.1) Lus10000637 [exp] 232 / 3e-77 AT5G65270 395 / 8e-142 RAB GTPase homolog A4A (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G249500 [exp] 339 / 7e-120 AT1G05810 333 / 8e-117 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A5E, RAB GTPase homolog A5E (.1) Potri.002G231800 [exp] 325 / 2e-114 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.014G150300 [exp] 322 / 5e-113 AT2G31680 374 / 1e-133 RAB GTPase homolog A5D (.1) Potri.006G015400 [exp] 262 / 4e-89 AT5G47520 398 / 5e-143 RAB GTPase homolog A5A (.1) Potri.016G010300 [exp] 262 / 4e-89 AT5G47520 395 / 7e-142 RAB GTPase homolog A5A (.1) Potri.006G000300 [exp] 233 / 1e-77 AT1G07410 400 / 4e-144 ARABIDOPSIS RAB GTPASE HOMOLOG A2B, RAB GTPase homolog A2B (.1) Potri.011G070300 [exp] 231 / 4e-77 AT5G45750 392 / 1e-140 RAB GTPase homolog A1C (.1) Potri.001G270100 [exp] 231 / 8e-77 AT3G12160 379 / 2e-135 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.006G057700 [exp] 230 / 1e-76 AT3G12160 387 / 1e-138 ARABIDOPSIS THALIANA RAB GTPASE HOMOLOG A4D, RAB GTPase homolog A4D (.1) Potri.003G004100 [exp] 229 / 2e-76 AT1G09630 382 / 6e-137 ARABIDOPSIS RAB GTPASE A2A, RAB GTPase 11C (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0023 [flax] [poplar] P-loop_NTPase PF00071 [flax] [poplar] Ras Ras family
Representative CDS sequence Show only first row Show all	>Lus10025876 pacid=23177672 polypeptide=Lus10025876 locus=Lus10025876.g ID=Lus10025876.BGIv1.0 annot-version=v1.0 ATGGGTGAATCACACGCAGATATAGGAGGAGGAGAAGGAGGAGAGGAGTATCTGTTCAAGATAGTAGTCATTGGCGACTCCGCAGTCGGCAAATCCAACT TACTTTCCAGATTCGCCACCAACGAATTCGACCCCAACTCCAAAGCCACCATTGGCGTCGAGTTCCAGACTCAAGTAGTCGAAATCGACGGCAAAGAAAT CAAAGCCCAGATCTGGGACACCGCCGGCCAGGAGCGCTTCCGTGCCGTCACCTCCGCCTACTACAGGGGCGCCGTCGGAGCCCTCATCGTCTACGACATC ACCCGCAAGACCACCTTCGAAAGCGTCAAACGCTGGCTCCAAGAACTCACCTTGCAGTGCGATACGACGGTGGGGAAGATGCTGGTGGGGAACAAGTGCG ATCTGGACGCGATTAGGGAAGTGAGCAAAGAGGAAGGGAAGAGGGTTGCTGAGGAAGAAGGATTGTTCTTCATGGAGACATCTGCTCTGGATTCAACCAA CGTTGAGGCTGCGTTTGAGGTAGTGATTCGTGAGATTTACAACAATCTCAGCAGGAAGTCTTTGAAGTCCGACTCTTATAAGGCTGCTTTGACTGTGAAC AGAGTCACCCTCGTCAACTCAGAATCCAAGCCTCGCAGTATTTCCTCCTGCTGTTCATCTTCTTGA
AA sequence Show only first row Show all	>Lus10025876 pacid=23177672 polypeptide=Lus10025876 locus=Lus10025876.g ID=Lus10025876.BGIv1.0 annot-version=v1.0 MGESHADIGGGEGGEEYLFKIVVIGDSAVGKSNLLSRFATNEFDPNSKATIGVEFQTQVVEIDGKEIKAQIWDTAGQERFRAVTSAYYRGAVGALIVYDI TRKTTFESVKRWLQELTLQCDTTVGKMLVGNKCDLDAIREVSKEEGKRVAEEEGLFFMETSALDSTNVEAAFEVVIREIYNNLSRKSLKSDSYKAALTVN RVTLVNSESKPRSISSCCSSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G05810		ARA, Ara-1, AtR...	ARABIDOPSIS THALIANA RAB GTPAS...		Lus10025876 [exp]	0	1
AT5G49170			unknown protein		Lus10006495 [exp]	3.6	0.9165
AT2G34790		MEE23, EDA28	MATERNAL EFFECT EMBRYO ARREST ...		Lus10023361 [exp]	4.7	0.9315
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Lus10005682 [exp]	4.9	0.9189
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10023212 [exp]	6.5	0.8941
AT3G16210			F-box family protein (.1)		Lus10023372 [exp]	6.7	0.9140
AT4G11950			Protein of unknown function (D...		Lus10014138 [exp]	12.4	0.9261
AT2G35860		FLA16	FASCICLIN-like arabinogalactan...		Lus10021247 [exp]	15.3	0.9209
AT5G60020		LAC17, ATLAC17	laccase 17 (.1)		Lus10019122 [exp]	20.1	0.9225
AT5G40020			Pathogenesis-related thaumatin...		Lus10008304 [exp]	20.5	0.9159
AT1G72790			hydroxyproline-rich glycoprote...		Lus10006024 [exp]	21.7	0.8871

Compare expression of checked genes

Lus10025876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.