Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25290 86 / 4e-21 Auxin-responsive family protein (.1.2) AT3G07390 76 / 9e-18 AIR12 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1) AT4G17280 73 / 3e-16 Auxin-responsive family protein (.1) AT4G12980 70 / 2e-15 Auxin-responsive family protein (.1) AT5G47530 70 / 3e-15 Auxin-responsive family protein (.1) AT5G35735 64 / 3e-13 Auxin-responsive family protein (.1) AT5G48750 60 / 7e-12 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1) AT3G59070 58 / 4e-11 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1) AT2G04850 43 / 8e-06 Auxin-responsive family protein (.1) AT1G36580 37 / 0.0007 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025879 [exp] 87 / 3e-22 AT3G07390 181 / 3e-56 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1) Lus10038224 [exp] 86 / 1e-21 AT3G07390 182 / 7e-57 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1) Lus10012350 [exp] 77 / 1e-17 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1) Lus10001734 [exp] 76 / 2e-17 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1) Lus10002274 [exp] 75 / 6e-17 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1) Lus10006398 [exp] 63 / 6e-13 AT5G47530 276 / 2e-91 Auxin-responsive family protein (.1) Lus10017564 [exp] 61 / 7e-12 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1) Lus10010498 [exp] 59 / 2e-11 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1) Lus10001736 [exp] 48 / 2e-07 AT2G04850 559 / 0.0 Auxin-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G249300 [exp] 97 / 4e-25 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2) Potri.002G249200 [exp] 79 / 5e-19 AT3G07390 158 / 3e-47 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1) Potri.006G015000 [exp] 70 / 2e-15 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1) Potri.016G010900 [exp] 66 / 8e-14 AT5G47530 498 / 8e-177 Auxin-responsive family protein (.1) Potri.010G156600 [exp] 66 / 9e-14 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1) Potri.010G156200 [exp] 64 / 2e-13 AT5G47530 472 / 1e-166 Auxin-responsive family protein (.1) Potri.014G162000 [exp] 63 / 7e-13 AT5G47530 369 / 2e-126 Auxin-responsive family protein (.1) Potri.019G096400 [exp] 58 / 5e-11 AT5G47530 309 / 2e-102 Auxin-responsive family protein (.1) Potri.014G161900 [exp] 57 / 5e-11 AT5G47530 157 / 2e-46 Auxin-responsive family protein (.1) Potri.013G118300 [exp] 57 / 1e-10 AT5G47530 305 / 7e-101 Auxin-responsive family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025878 pacid=23177477 polypeptide=Lus10025878 locus=Lus10025878.g ID=Lus10025878.BGIv1.0 annot-version=v1.0 ATGGCGTCTCTTCTTCTCCTCCGCCTCTTCACTCTTGCTGCTACGGCCTTTTCCTTGTCTCTTTCCCCCATTCCCACTGCGCATTCCCAGACTTGCAACT CCCAACGCTTCGCCGGCAGCAACAGTGTCTACGCCAACTGCTTGGACCTCCCTGCTCTCTCCTCGTTTCTCCACTTCACCTTCGATTCCTCCAATTCCAC TCTCTCCGTCGCCTTCCTAGCCTCCCCGCCTACCTCCGCCGGCTGGATTTCCTGGGCTATTAACCCCACAGCGCCACTGATGGCCGGTGCTCGCCGGCTG GATTTCCTGGACTATTAA
AA sequence Show only first row Show all	>Lus10025878 pacid=23177477 polypeptide=Lus10025878 locus=Lus10025878.g ID=Lus10025878.BGIv1.0 annot-version=v1.0 MASLLLLRLFTLAATAFSLSLSPIPTAHSQTCNSQRFAGSNSVYANCLDLPALSSFLHFTFDSSNSTLSVAFLASPPTSAGWISWAINPTAPLMAGARRL DFLDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25290			Auxin-responsive family protei...		Lus10025878 [exp]	0	1
AT1G08290	C2H2ZnF	WIP3	WIP domain protein 3 (.1)		Lus10004887 [exp]	3.7	0.9526
AT3G50760		GATL2	galacturonosyltransferase-like...		Lus10016302 [exp]	8.8	0.9469
AT3G49260		IQD21	IQ-domain 21 (.1.2.3)		Lus10022399 [exp]	9.2	0.9494
AT3G59310			Eukaryotic protein of unknown ...		Lus10025530 [exp]	9.8	0.9462
AT3G25290			Auxin-responsive family protei...		Lus10025877 [exp]	9.9	0.9491
AT5G46220			Protein of unknown function (D...		Lus10023312 [exp]	10.2	0.9462
AT2G38120		MAP1, WAV5, PIR...	WAVY ROOTS 5, MODIFIER OF ARF7...		Lus10028278 [exp]	10.5	0.9452
AT3G59690		IQD13	IQ-domain 13 (.1)		Lus10025593 [exp]	15.9	0.9478
					Lus10016571 [exp]	16.9	0.9428
AT3G13050		AtNiaP	nicotinate transporter, Major ...		Lus10043061 [exp]	21.4	0.9470

Compare expression of checked genes

Lus10025878 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.