Lus10025879 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07390 163 / 2e-49 AIR12 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
AT3G25290 145 / 4e-41 Auxin-responsive family protein (.1.2)
AT4G12980 140 / 2e-39 Auxin-responsive family protein (.1)
AT5G47530 104 / 5e-26 Auxin-responsive family protein (.1)
AT5G35735 100 / 2e-24 Auxin-responsive family protein (.1)
AT5G48750 95 / 3e-23 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT4G17280 97 / 5e-23 Auxin-responsive family protein (.1)
AT3G59070 92 / 3e-21 Cytochrome b561/ferric reductase transmembrane with DOMON related domain (.1)
AT2G04850 72 / 2e-14 Auxin-responsive family protein (.1)
AT1G36580 41 / 0.0002 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038224 352 / 6e-124 AT3G07390 182 / 7e-57 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
Lus10002274 106 / 2e-26 AT5G47530 432 / 4e-151 Auxin-responsive family protein (.1)
Lus10001734 103 / 1e-25 AT5G47530 422 / 9e-147 Auxin-responsive family protein (.1)
Lus10012350 102 / 6e-25 AT5G35735 418 / 3e-145 Auxin-responsive family protein (.1)
Lus10025878 89 / 2e-22 AT3G25290 88 / 8e-22 Auxin-responsive family protein (.1.2)
Lus10010498 87 / 2e-19 AT5G47530 412 / 1e-142 Auxin-responsive family protein (.1)
Lus10017564 80 / 6e-17 AT5G47530 419 / 8e-146 Auxin-responsive family protein (.1)
Lus10025877 73 / 8e-15 AT3G25290 387 / 2e-134 Auxin-responsive family protein (.1.2)
Lus10001736 64 / 2e-11 AT2G04850 559 / 0.0 Auxin-responsive family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G249200 222 / 1e-72 AT3G07390 158 / 3e-47 Auxin-Induced in Root cultures 12, auxin-responsive family protein (.1)
Potri.002G249300 143 / 2e-40 AT3G25290 452 / 6e-159 Auxin-responsive family protein (.1.2)
Potri.019G096400 119 / 3e-31 AT5G47530 309 / 2e-102 Auxin-responsive family protein (.1)
Potri.001G031600 115 / 5e-30 AT5G47530 312 / 7e-104 Auxin-responsive family protein (.1)
Potri.019G096300 115 / 6e-30 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.013G118300 114 / 1e-29 AT5G47530 305 / 7e-101 Auxin-responsive family protein (.1)
Potri.019G095800 114 / 2e-29 AT5G47530 310 / 7e-103 Auxin-responsive family protein (.1)
Potri.006G015000 106 / 2e-26 AT5G47530 513 / 0.0 Auxin-responsive family protein (.1)
Potri.016G010900 105 / 3e-26 AT5G47530 498 / 8e-177 Auxin-responsive family protein (.1)
Potri.010G156600 105 / 3e-26 AT5G47530 497 / 2e-176 Auxin-responsive family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04526 DUF568 Protein of unknown function (DUF568)
Representative CDS sequence
>Lus10025879 pacid=23177502 polypeptide=Lus10025879 locus=Lus10025879.g ID=Lus10025879.BGIv1.0 annot-version=v1.0
ATGGCGTCTCCCTTCTCTTCTTGCCTCGCCATTTCCATCTCTCTGCTACTCATCATCCCTGCACATTCCCTCACCTCCCCCTGCGATCAGAAATTCAAAA
ACAACAAAATCTACGCCAATTGCACTTCCCTCCCTGCTCTCTCCTCCATCCTACACTATACCTTCAACTCCACCAATTCCTCCCTCTCCGTCGCCTTCCT
CGCCGCCCCCCCCCCCCCCACCGGCTGGGTCGCCTGGGGAATCAACCCTAACGGCACCGGAATGGCCGGCGCTCAGGCTCTCGTCGCCCTCCCCGGCGCC
GGCGGAAGCCTCGTCGTCAAGACCTTCAACCTCATCTCCTACGGCAGCATCAAGGAGGAGAAGCTCTCCTTCGACGTCTGGGATCTCGAAGTCGAGTCCA
TGAACGGCACCACCGCCATTTTCGCCTCCGTCAAGATCCCCGCCGGAGCCGAGAAGGTGAACCACATCTGGCAGGTCGGCGCCGCGGTTAACAAAGGGAG
TCCTGGTAAGCACGAGTTTGCCCCCTCAAATCTGGCTGTGAAGGAGACTCTTCAGTTGACCGGTAACCCCGCTCCTGCTCCCGGTTCTTCTCCGGCACCG
GCTAGCGGGTCTCCCGCACCTGCTAGCGGGTCCTGTTCGGATGATGGCACCAGTGGTGGTTACAGTTACAGGGGAAGGGAGATGAAGGTTGGATTGTACG
GTGGGGTGGCGTTGGTTATTCTGGCTGGTTTGACCATTGGGTTGTAA
AA sequence
>Lus10025879 pacid=23177502 polypeptide=Lus10025879 locus=Lus10025879.g ID=Lus10025879.BGIv1.0 annot-version=v1.0
MASPFSSCLAISISLLLIIPAHSLTSPCDQKFKNNKIYANCTSLPALSSILHYTFNSTNSSLSVAFLAAPPPPTGWVAWGINPNGTGMAGAQALVALPGA
GGSLVVKTFNLISYGSIKEEKLSFDVWDLEVESMNGTTAIFASVKIPAGAEKVNHIWQVGAAVNKGSPGKHEFAPSNLAVKETLQLTGNPAPAPGSSPAP
ASGSPAPASGSCSDDGTSGGYSYRGREMKVGLYGGVALVILAGLTIGL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07390 AIR12 Auxin-Induced in Root cultures... Lus10025879 0 1
AT1G19300 ATGATL1, GATL1,... PARVUS, GAOLAOZHUANGREN 1, GAL... Lus10010789 3.0 0.9659
AT5G12890 UDP-Glycosyltransferase superf... Lus10031248 6.0 0.9473
AT1G19300 ATGATL1, GATL1,... PARVUS, GAOLAOZHUANGREN 1, GAL... Lus10016301 6.5 0.9604
AT1G17620 Late embryogenesis abundant (L... Lus10037638 6.6 0.9510
AT2G01950 VH1, BRL2 VASCULAR HIGHWAY 1, BRI1-like ... Lus10039132 6.6 0.9455
AT1G46480 HD WOX4 WUSCHEL related homeobox 4 (.1... Lus10018726 7.2 0.9415
AT3G57880 Calcium-dependent lipid-bindin... Lus10016280 9.2 0.9405
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10022680 11.0 0.9510
AT2G41610 unknown protein Lus10030172 12.7 0.9551
AT1G46480 HD WOX4 WUSCHEL related homeobox 4 (.1... Lus10024808 12.7 0.9303

Lus10025879 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.