Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G07370 375 / 4e-132 ATCHIP, CHIP carboxyl terminus of HSC70-interacting protein (.1) AT2G42810 71 / 8e-14 AtPP5, PP5.2, PP5, PAPP5 Arabidopsis thaliana protein phosphatase 5, protein phosphatase 5.2 (.1.2) AT1G56440 63 / 5e-11 TPR5 tetratricopeptide repeat 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT2G45920 61 / 2e-10 U-box domain-containing protein (.1) AT1G01670 61 / 3e-10 RING/U-box superfamily protein (.1) AT3G17970 61 / 3e-10 ATTOC64-III translocon at the outer membrane of chloroplasts 64-III (.1) AT3G61390 59 / 9e-10 RING/U-box superfamily protein (.1.2) AT1G01660 58 / 3e-09 RING/U-box superfamily protein (.1) AT4G08320 56 / 8e-09 TPR8 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT4G11260 56 / 1e-08 RPR1, ETA3, EDM1, ATSGT1B, SGT1B ENHANCER OF TIR1-1 AUXIN RESISTANCE 3, ENHANCED DOWNY MILDEW 1, phosphatase-related (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038219 [exp] 564 / 0 AT3G07370 372 / 6e-131 carboxyl terminus of HSC70-interacting protein (.1) Lus10020412 [exp] 442 / 2e-158 AT3G07370 358 / 2e-125 carboxyl terminus of HSC70-interacting protein (.1) Lus10009593 [exp] 436 / 6e-156 AT3G07370 356 / 2e-124 carboxyl terminus of HSC70-interacting protein (.1) Lus10034113 [exp] 64 / 3e-11 AT3G59770 1913 / 0.0 ARABIDOPSIS THALIANA SUPPRESSOR OF ACTIN 9, sacI homology domain-containing protein / WW domain-containing protein (.1.2.3) Lus10043471 [exp] 60 / 5e-10 AT1G71020 682 / 0.0 ARM repeat superfamily protein (.1.2) Lus10018004 [exp] 60 / 6e-10 AT3G17970 711 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Lus10031418 [exp] 59 / 1e-09 AT1G56440 436 / 1e-150 tetratricopeptide repeat 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10018179 [exp] 57 / 4e-09 AT4G08320 389 / 9e-134 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Lus10025656 [exp] 57 / 4e-09 AT4G08320 379 / 9e-130 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G248700 [exp] 403 / 7e-143 AT3G07370 387 / 7e-137 carboxyl terminus of HSC70-interacting protein (.1) Potri.005G177400 [exp] 61 / 2e-10 AT4G08320 406 / 1e-139 tetratricopeptide repeat 8, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.005G014100 [exp] 61 / 2e-10 AT1G56440 476 / 1e-165 tetratricopeptide repeat 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.014G141800 [exp] 60 / 6e-10 AT2G42810 895 / 0.0 Arabidopsis thaliana protein phosphatase 5, protein phosphatase 5.2 (.1.2) Potri.001G205300 [exp] 58 / 2e-09 AT5G09420 724 / 0.0 outer membrane 64, ARABIDOPSIS THALIANA TRANSLOCON AT THE OUTER MEMBRANE OF CHLOROPLASTS 64-V, translocon at the outer membrane of chloroplasts 64-V (.1) Potri.013G008400 [exp] 57 / 6e-09 AT1G56440 471 / 1e-163 tetratricopeptide repeat 5, Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.011G111500 [exp] 57 / 7e-09 AT1G53300 707 / 0.0 tetratricopetide-repeat thioredoxin-like 1 (.1) Potri.015G038600 [exp] 56 / 1e-08 AT3G17970 747 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1) Potri.001G216300 [exp] 55 / 2e-08 AT3G11840 303 / 6e-99 plant U-box 24 (.1) Potri.012G046900 [exp] 55 / 2e-08 AT3G17970 744 / 0.0 translocon at the outer membrane of chloroplasts 64-III (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [flax] [poplar] RING PF04564 [flax] [poplar] U-box U-box domain CL0020 [flax] [poplar] TPR PF00515 [flax] [poplar] TPR_1 Tetratricopeptide repeat
Representative CDS sequence Show only first row Show all	>Lus10025884 pacid=23177681 polypeptide=Lus10025884 locus=Lus10025884.g ID=Lus10025884.BGIv1.0 annot-version=v1.0 ATGGGGCAGGGAATTGTATTGACTCCGGCGAAACAAGCTGAGAGATTGAAAGAGAATGGAAATGCCTACTTCAAGAAAGAACGATTCGCTGCTGCCATCG ACGCTTACACCGAGGCGATTGTGCTGTGCCCTAATGTTGCTGTGTACTGGACCAATCGAGCTCTTTGTCATCGTAAACGCAATAACTGGAAGAAAGTTGA AGAGGATTGTCTTTCGGCGATCAAGCTTGATAACAATTCTTTTAAGGCTCACTATATGCTGGGACTTGCTTTACTCCAGAGGGAAGAGTACACAGAAGGA CTCAAGGCATTGGAAAGAGCAATGGATCTTAGCAGGGATGCGAACCCACCAGGTTATATGGTGGAGGAGGTTTGGCAAGAGATTGCGAAAACAAAATACC TGCTGTGGGAGCAAGCATCCACACAACGTTCATGGGAATTACAGAGCTTGAAAGAAGCTTGTGAAAGCGCTCTTAAAGAGAAGTACTTTCTCGATGATAA TAAGAAAGATGGAGTTTCAGAGGAGGCAGCTGCCTTCCATGAGCAACAGTTGGATACGCTAAAGAAAGTGTTTGAGAAGGCAGCAGAAGATGACATCCCG ACCGAGATACCAGATTATCTTTGTTGCAAAATCTCGCTCGATATCTTCCACGACCCTGTCATCACTCCAAGCGGGTTAACGTACGAAAAAGCAGTGATTC TTGATCATCTTCAGAAGGTGGGGAGGTTTGATCCAATCACACGGGTAGAACTTGAACCATCTCAGTTGATCCCAAACCTGGCAATCAAGGAAGCCGTCCA AACGTATCTTCAGAAACATGGTTGGGCATATAAAGCTGACTGA
AA sequence Show only first row Show all	>Lus10025884 pacid=23177681 polypeptide=Lus10025884 locus=Lus10025884.g ID=Lus10025884.BGIv1.0 annot-version=v1.0 MGQGIVLTPAKQAERLKENGNAYFKKERFAAAIDAYTEAIVLCPNVAVYWTNRALCHRKRNNWKKVEEDCLSAIKLDNNSFKAHYMLGLALLQREEYTEG LKALERAMDLSRDANPPGYMVEEVWQEIAKTKYLLWEQASTQRSWELQSLKEACESALKEKYFLDDNKKDGVSEEAAAFHEQQLDTLKKVFEKAAEDDIP TEIPDYLCCKISLDIFHDPVITPSGLTYEKAVILDHLQKVGRFDPITRVELEPSQLIPNLAIKEAVQTYLQKHGWAYKAD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07370		ATCHIP, CHIP	carboxyl terminus of HSC70-int...		Lus10025884 [exp]	0	1
AT1G16670			Protein kinase superfamily pro...		Lus10026503 [exp]	2.0	0.9422
AT3G10915			Reticulon family protein (.1.2...		Lus10034224 [exp]	2.2	0.9529
AT3G18620			DHHC-type zinc finger family p...		Lus10013426 [exp]	3.9	0.9458
AT3G12250	bZIP	BZIP45, TGA6	TGACG motif-binding factor 6 (...		Lus10024140 [exp]	4.2	0.9470
AT1G31120		KUP10	K+ uptake permease 10, K+ upta...		Lus10038362 [exp]	5.5	0.9238
AT5G58740			HSP20-like chaperones superfam...		Lus10018234 [exp]	8.1	0.9234
AT3G18820		RAB71, AtRABG3f...	RAB GTPase homolog G3F (.1)		Lus10042328 [exp]	9.4	0.9140
AT3G05660		AtRLP33	receptor like protein 33 (.1)		Lus10002214 [exp]	9.7	0.9341
AT5G35690			unknown protein		Lus10002262 [exp]	12.8	0.9097
AT1G02305			Cysteine proteinases superfami...		Lus10007212 [exp]	13.4	0.9315

Compare expression of checked genes

Lus10025884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.