Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G48580 198 / 3e-66 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT3G25220 196 / 1e-65 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT3G25230 107 / 5e-28 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) AT5G48570 105 / 3e-27 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G45680 97 / 9e-26 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT4G39710 89 / 9e-23 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT4G25340 81 / 7e-19 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT3G55520 78 / 8e-19 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 76 / 1e-18 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G43560 70 / 2e-15 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038215 [exp] 236 / 1e-77 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10002339 [exp] 214 / 1e-72 AT3G25220 227 / 1e-77 FK506-binding protein 15 kD-1 (.1) Lus10003170 [exp] 211 / 9e-72 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1) Lus10035800 [exp] 156 / 3e-50 AT5G48580 127 / 1e-38 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10002338 [exp] 106 / 1e-27 AT3G25230 874 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10003171 [exp] 105 / 2e-27 AT3G25230 871 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10038216 [exp] 105 / 2e-27 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10025888 [exp] 105 / 3e-27 AT3G25230 870 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Lus10006949 [exp] 94 / 7e-25 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G248200 [exp] 210 / 2e-71 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.014G149400 [exp] 110 / 5e-29 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.002G248300 [exp] 106 / 1e-27 AT3G25230 857 / 0.0 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2) Potri.001G075500 [exp] 96 / 2e-25 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.012G129200 [exp] 97 / 2e-24 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.006G033400 [exp] 92 / 8e-23 AT5G48570 596 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 90 / 7e-22 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.005G079700 [exp] 82 / 6e-20 AT4G39710 243 / 1e-81 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.008G057900 [exp] 75 / 2e-17 AT3G55520 236 / 7e-80 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.010G201600 [exp] 73 / 6e-17 AT3G55520 219 / 2e-73 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10025889 pacid=23177509 polypeptide=Lus10025889 locus=Lus10025889.g ID=Lus10025889.BGIv1.0 annot-version=v1.0 ATGCTTACTGTTACTGTTGTTCTTATGTTTGGTGATCCTTTGGCGTGGCAGCACAAACCCGAATCTTGTGATATTCAGGCCCATAAGGGAGACAAGATCA AAGTACACTACAGGGGAAAACTCACTGATGGCACTGTTTTCGACTCCAGCTTTGAGAGAGGCGATCCTATAGATTTTGAGCTTGGCAGTGGGCAAGTTAT CAAAGGATGGGACCAAGGACTGTTGGGGATGTGCGTAGGTGAGAAGCGGAAGTTGAAAATTCCTGCAAAACTTGGTTATGGCGACCAAGGCTCTCCCCCT ACGATTCCAGGTGGAGCGACATTGATATTCGATACGGAGCTTGTTGCTGTAAATGGGAAGACAAAGGGAGGAGAGACTGCAAAAGATAGTGAGCTCTAG
AA sequence Show only first row Show all	>Lus10025889 pacid=23177509 polypeptide=Lus10025889 locus=Lus10025889.g ID=Lus10025889.BGIv1.0 annot-version=v1.0 MLTVTVVLMFGDPLAWQHKPESCDIQAHKGDKIKVHYRGKLTDGTVFDSSFERGDPIDFELGSGQVIKGWDQGLLGMCVGEKRKLKIPAKLGYGDQGSPP TIPGGATLIFDTELVAVNGKTKGGETAKDSEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G48580		FKBP15-2	FK506- and rapamycin-binding p...		Lus10025889 [exp]	0	1
AT4G22310			Uncharacterised protein family...		Lus10011790 [exp]	3.5	0.9106
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Lus10035780 [exp]	6.0	0.8774
AT1G54730			Major facilitator superfamily ...		Lus10035354 [exp]	11.5	0.8676
AT4G20330			Transcription initiation facto...		Lus10002233 [exp]	13.0	0.8886
AT5G52840			NADH-ubiquinone oxidoreductase...		Lus10038835 [exp]	15.7	0.8585
AT1G56700			Peptidase C15, pyroglutamyl pe...		Lus10001521 [exp]	16.5	0.9078
AT1G66240		ATX1, ATATX1	homolog of anti-oxidant 1 (.1....		Lus10028859 [exp]	18.0	0.8690
AT4G22310			Uncharacterised protein family...		Lus10023745 [exp]	20.0	0.9084
AT5G03030			Chaperone DnaJ-domain superfam...		Lus10023494 [exp]	20.9	0.8886
AT5G53070			Ribosomal protein L9/RNase H1 ...		Lus10005909 [exp]	21.6	0.8605

Compare expression of checked genes

Lus10025889 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.