Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G34280 45 / 2e-05 F-box and associated interaction domains-containing protein (.1) AT2G16810 44 / 3e-05 F-box and associated interaction domains-containing protein (.1) AT2G19630 44 / 5e-05 F-box and associated interaction domains-containing protein (.1.2) AT1G46984 43 / 7e-05 F-box family protein (.1) AT1G47790 43 / 0.0001 F-box and associated interaction domains-containing protein (.1) AT5G18160 42 / 0.0001 F-box and associated interaction domains-containing protein (.1) AT1G11270 42 / 0.0001 F-box and associated interaction domains-containing protein (.1.2.3) AT1G50870 42 / 0.0002 F-box and associated interaction domains-containing protein (.1) AT1G71320 42 / 0.0002 F-box family protein (.1) AT1G09650 42 / 0.0002 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038210 [exp] 226 / 5e-73 AT1G71320 47 / 1e-05 F-box family protein (.1) Lus10040338 [exp] 156 / 1e-45 AT4G12560 78 / 1e-15 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10010910 [exp] 115 / 3e-30 AT3G23880 101 / 1e-23 F-box and associated interaction domains-containing protein (.1) Lus10040463 [exp] 104 / 4e-26 AT4G12560 117 / 7e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031480 [exp] 100 / 2e-24 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031478 [exp] 100 / 2e-24 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10000190 [exp] 100 / 2e-24 AT4G12560 127 / 2e-32 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Lus10031512 [exp] 91 / 2e-21 AT3G16210 100 / 8e-23 F-box family protein (.1) Lus10031493 [exp] 76 / 6e-16 AT3G05500 285 / 4e-96 Rubber elongation factor protein (REF) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G011400 [exp] 57 / 2e-09 AT4G12560 142 / 2e-38 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.017G058900 [exp] 55 / 7e-09 AT3G06240 132 / 2e-34 F-box family protein (.1) Potri.001G318400 [exp] 48 / 1e-06 AT3G06240 142 / 3e-38 F-box family protein (.1) Potri.011G121200 [exp] 47 / 3e-06 AT4G12560 116 / 9e-29 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.012G014700 [exp] 47 / 3e-06 AT1G12170 66 / 1e-11 F-box family protein (.1) Potri.006G012900 [exp] 47 / 3e-06 AT4G12560 144 / 2e-39 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.008G199601 [exp] 45 / 3e-06 AT3G06240 61 / 2e-12 F-box family protein (.1) Potri.001G035500 [exp] 47 / 4e-06 AT4G12560 271 / 3e-87 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.006G013000 [exp] 45 / 1e-05 AT4G12560 250 / 5e-79 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2) Potri.001G262900 [exp] 45 / 2e-05 AT4G12560 107 / 5e-26 CONSTITUTIVE EXPRESSER OF PR GENES 30, CONSTITUTIVE EXPRESSER OF PR GENES 1, F-box and associated interaction domains-containing protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0271 [flax] [poplar] F-box PF00646 [flax] [poplar] F-box F-box domain
Representative CDS sequence Show only first row Show all	>Lus10025893 pacid=23177523 polypeptide=Lus10025893 locus=Lus10025893.g ID=Lus10025893.BGIv1.0 annot-version=v1.0 ATGATGGATCACATTCCACAGGAAGTGATGACCAACATTCTGCAGCGACTCGGCGTCAAGGATCTGGTAAGATGCAGGCGGGTCTCGAAACAGTGGCTCT CCAAACTCGACAGCCCCCAGTTCATCCGTAACCAACTCATCCGCCCCTCTATGTCCACCACAAACTCAAACGCTGCCCTTTTCCTTCAACCCCAAGCGAA GAACACTAATTTCCTCTGCTGGAAAGAAGAGTACCATGGCAGCAGAAATAAAGAAGGAGGTTTCTCCTCCTCTGGTCCTATCGAGTACCATTACGAACCT GATCAAGTGCTATTCATGGGTGCTTGCCATGGCTTGATATGCTTTACTCGTGTTCACCATCCACATCATCTTGTTGTCCTGAATCCATGGGCAGCTGAGC GTAAAGTGGTCAGCAGTTTCTTGGATGATGAAGAATTTCAGAAGCTAATTATGACAAAATATCTCAAGATGCAGATTCCATGGCATCAGGTAACAGACGA ACAACCTGTTCCAACTATTGAATGTGTGCGATTCAGGTCATCTTATGTGCGTGAGAAGGAGAATTTCATGGACATTTTGTTTAGGGTTTGTCACCCGAAA TCCATATGTGCTTCAAAAGGAGAAGATAGTTCAGATGATTATTTGTTAAGCCTTTAG
AA sequence Show only first row Show all	>Lus10025893 pacid=23177523 polypeptide=Lus10025893 locus=Lus10025893.g ID=Lus10025893.BGIv1.0 annot-version=v1.0 MMDHIPQEVMTNILQRLGVKDLVRCRRVSKQWLSKLDSPQFIRNQLIRPSMSTTNSNAALFLQPQAKNTNFLCWKEEYHGSRNKEGGFSSSGPIEYHYEP DQVLFMGACHGLICFTRVHHPHHLVVLNPWAAERKVVSSFLDDEEFQKLIMTKYLKMQIPWHQVTDEQPVPTIECVRFRSSYVREKENFMDILFRVCHPK SICASKGEDSSDDYLLSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G11270			F-box and associated interacti...		Lus10025893 [exp]	0	1
AT1G05170			Galactosyltransferase family p...		Lus10002079 [exp]	1.4	0.8848
AT2G16280		KCS9	3-ketoacyl-CoA synthase 9 (.1)		Lus10040578 [exp]	2.4	0.8677
AT3G15200			Tetratricopeptide repeat (TPR)...		Lus10031269 [exp]	3.0	0.8587
AT5G27530			Pectin lyase-like superfamily ...		Lus10036205 [exp]	3.2	0.8698
AT1G05170			Galactosyltransferase family p...		Lus10001148 [exp]	3.5	0.8711
AT5G61280			Remorin family protein (.1)		Lus10034714 [exp]	5.3	0.8642
AT1G30690			Sec14p-like phosphatidylinosit...		Lus10031752 [exp]	5.9	0.8064
AT1G19780		ATCNGC8	cyclic nucleotide gated channe...		Lus10041662 [exp]	6.0	0.8044
AT5G61210		SNP33, ATSNAP33...	soluble N-ethylmaleimide-sensi...		Lus10015738 [exp]	7.1	0.8830
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10023629 [exp]	8.8	0.8725

Compare expression of checked genes

Lus10025893 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.