Lus10025894 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038209 146 / 2e-44 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10025894 pacid=23177636 polypeptide=Lus10025894 locus=Lus10025894.g ID=Lus10025894.BGIv1.0 annot-version=v1.0
ATGGAGTTTGATGAGCTTCTCCAACTGATCAAGCCTATACTAAAGGGATTCATTCTTCAGAAAGGGATAGAATATGTTGTCCTATTCCTCCCCGGCCCTA
CCGGTCAAATATTGAGCGTCCTCGTAACATTGTACCAGCTGCCGGTCTTTGAGGAATACAAGGAGACTCTGGCTGATCATTTGGGTCGCTTTCTTCGTCG
TCTGTGTGATTCCATTGTTGCAAAGGCTGCTACTTTGATGAACAAGATGTCAGCAATAATCTCCTCCATCGAAGGCTGGTTTAGCAAGCTCATTCAGCCC
GCCAAGAAAATGGGGATGAAGGTAGTGGTGTCATTGAAGACGATGGCAACTAGAGTATTCTCTGCTGGAGCAAGATTCGCTACTCGTGTCCTGTCTGCTT
TGCGCTTCTTTTGA
AA sequence
>Lus10025894 pacid=23177636 polypeptide=Lus10025894 locus=Lus10025894.g ID=Lus10025894.BGIv1.0 annot-version=v1.0
MEFDELLQLIKPILKGFILQKGIEYVVLFLPGPTGQILSVLVTLYQLPVFEEYKETLADHLGRFLRRLCDSIVAKAATLMNKMSAIISSIEGWFSKLIQP
AKKMGMKVVVSLKTMATRVFSAGARFATRVLSALRFF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025894 0 1
AT1G48120 hydrolases;protein serine/thre... Lus10008569 4.6 1.0000
Lus10024550 6.3 1.0000
AT5G49720 TSD1, IRX2, DEC... TUMOROUS SHOOT DEVELOPMENT 1, ... Lus10028619 7.9 1.0000
AT5G46795 MSP2 microspore-specific promoter ... Lus10004566 12.6 1.0000
AT4G01830 ABCB5, PGP5 ATP-binding cassette B5, P-gly... Lus10004529 13.7 1.0000
Lus10010778 14.9 1.0000
Lus10011061 16.3 1.0000
Lus10011496 18.3 1.0000
AT3G07740 HXA2, HXA02, HA... homolog of yeast ADA2 2A (.1.2... Lus10012337 18.8 1.0000
Lus10000550 20.4 1.0000

Lus10025894 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.