Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G18020 112 / 4e-34 SAUR-like auxin-responsive protein family (.1) AT4G38840 112 / 1e-33 SAUR-like auxin-responsive protein family (.1) AT5G18050 111 / 2e-33 SAUR-like auxin-responsive protein family (.1) AT5G18030 110 / 5e-33 SAUR-like auxin-responsive protein family (.1) AT5G18060 109 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT2G21200 107 / 3e-32 SAUR-like auxin-responsive protein family (.1) AT5G18080 107 / 7e-32 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18010 107 / 7e-32 SAUR19, SAUR24 small auxin up RNA 19, SAUR-like auxin-responsive protein family (.1) AT4G38825 101 / 1e-29 SAUR-like auxin-responsive protein family (.1) AT3G03840 100 / 5e-29 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038191 [exp] 163 / 7e-54 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10009624 [exp] 159 / 2e-52 AT4G38840 119 / 9e-37 SAUR-like auxin-responsive protein family (.1) Lus10009627 [exp] 158 / 7e-52 AT4G38840 118 / 3e-36 SAUR-like auxin-responsive protein family (.1) Lus10009000 [exp] 157 / 1e-51 AT4G38840 118 / 5e-36 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 146 / 4e-47 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 146 / 4e-47 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009001 [exp] 146 / 4e-47 AT4G38840 122 / 9e-38 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 144 / 1e-46 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Lus10008996 [exp] 144 / 2e-46 AT4G38840 116 / 2e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 133 / 5e-42 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 130 / 8e-41 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 125 / 6e-39 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 117 / 7e-36 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 117 / 9e-36 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 114 / 1e-34 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 112 / 1e-33 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 110 / 3e-33 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 108 / 4e-32 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G165400 [exp] 107 / 5e-32 AT5G18080 110 / 3e-33 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10025910 pacid=23177568 polypeptide=Lus10025910 locus=Lus10025910.g ID=Lus10025910.BGIv1.0 annot-version=v1.0 ATGGGTATTGGATTGCCTGGTAATCTTGCTAAGCAAATTCTCCGACGAACTGGGTCTGGATCGGGTAGAGGATCCTCTTCAAAGTTTCAAGATGTGCCGA AAGGGTACTTAGCAGTATATGTTGGAGAGACGCAGAAGAAGAGATTCGTTGTTCCACTTTCCTACTTGAGCCAGTCTTCATTTCAAGACTTGTTGAGCAT GGCTGAGGATGAATTCGGGTTTGATCATCCAATGGGTGGATTGACCATTCCCTGCAGTGAAGGAACTTTTGTTGCTGTTACTTCAAGCTTTAGCAGATGA
AA sequence Show only first row Show all	>Lus10025910 pacid=23177568 polypeptide=Lus10025910 locus=Lus10025910.g ID=Lus10025910.BGIv1.0 annot-version=v1.0 MGIGLPGNLAKQILRRTGSGSGRGSSSKFQDVPKGYLAVYVGETQKKRFVVPLSYLSQSSFQDLLSMAEDEFGFDHPMGGLTIPCSEGTFVAVTSSFSR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025910 [exp]	0	1
AT4G38840			SAUR-like auxin-responsive pro...		Lus10038193 [exp]	1.0	0.9637
AT4G38840			SAUR-like auxin-responsive pro...		Lus10038191 [exp]	2.0	0.9038
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10029038 [exp]	6.0	0.8330
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10024853 [exp]	7.1	0.8585
AT3G46060		ARA3, Ara-3, At...	RAB GTPase homolog 8A (.1.2.3)		Lus10005443 [exp]	8.9	0.7854
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025911 [exp]	9.7	0.8317
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008897 [exp]	9.8	0.8092
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10002777 [exp]	13.9	0.8225
AT5G18020			SAUR-like auxin-responsive pro...		Lus10039020 [exp]	14.2	0.8096
AT2G40610		ATHEXPALPHA1.11...	expansin A8 (.1)		Lus10034227 [exp]	17.2	0.7996

Compare expression of checked genes

Lus10025910 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.