Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38840 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) AT4G34770 112 / 1e-33 SAUR-like auxin-responsive protein family (.1) AT5G18030 110 / 5e-33 SAUR-like auxin-responsive protein family (.1) AT5G18020 109 / 9e-33 SAUR-like auxin-responsive protein family (.1) AT5G18050 108 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT5G18060 108 / 1e-32 SAUR-like auxin-responsive protein family (.1) AT3G03840 108 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT2G21200 108 / 2e-32 SAUR-like auxin-responsive protein family (.1) AT5G18080 108 / 3e-32 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT2G21210 108 / 4e-32 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008999 [exp] 164 / 3e-54 AT4G38840 117 / 7e-36 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 162 / 2e-53 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1) Lus10008991 [exp] 161 / 5e-53 AT4G38840 115 / 4e-35 SAUR-like auxin-responsive protein family (.1) Lus10008995 [exp] 161 / 6e-53 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10029198 [exp] 152 / 1e-49 AT4G38840 119 / 2e-36 SAUR-like auxin-responsive protein family (.1) Lus10008992 [exp] 152 / 1e-49 AT2G21200 116 / 2e-35 SAUR-like auxin-responsive protein family (.1) Lus10009623 [exp] 150 / 1e-48 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10009628 [exp] 150 / 1e-48 AT4G38840 123 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10038192 [exp] 149 / 2e-48 AT4G34770 115 / 6e-35 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G126700 [exp] 136 / 2e-43 AT4G38840 126 / 3e-39 SAUR-like auxin-responsive protein family (.1) Potri.009G126300 [exp] 131 / 2e-41 AT5G18060 123 / 2e-38 SAUR-like auxin-responsive protein family (.1) Potri.009G126500 [exp] 131 / 2e-41 AT5G18020 124 / 1e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165200 [exp] 127 / 1e-39 AT5G18020 122 / 6e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G164800 [exp] 127 / 1e-39 AT4G38840 120 / 3e-37 SAUR-like auxin-responsive protein family (.1) Potri.009G126400 [exp] 124 / 1e-38 AT5G18020 119 / 1e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G164600 [exp] 122 / 6e-38 AT4G38840 115 / 5e-35 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 109 / 1e-32 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.004G165600 [exp] 108 / 3e-32 AT4G34770 118 / 4e-36 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 106 / 3e-31 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10025911 pacid=23177607 polypeptide=Lus10025911 locus=Lus10025911.g ID=Lus10025911.BGIv1.0 annot-version=v1.0 ATGGCCATTGGATTGCCAAGTAGCCTAGCCAAGCAGATCCTCCGAAGAACTGGCTCCGGATCAAGCAAATCATCTTCAAGGTTTCAAGATGTGCCGAAGG GGTTCTTAGCCGTGTATGTTGGAGAAGCGTTACAAAGGAAGAGATTTGTTGTTCCGATGTCCTATCTGAGCCAGCCTTTGTTTCAGGATCTGCTGAGCAT GGCTGAGGAGGAATTCGGGTTTGATCATCCAATGGGTGGATTGACCATTCCTTGCAGTGAAGAGACATTCATTGCTGCAACTTCAAGCTTGACCAGATTA TAA
AA sequence Show only first row Show all	>Lus10025911 pacid=23177607 polypeptide=Lus10025911 locus=Lus10025911.g ID=Lus10025911.BGIv1.0 annot-version=v1.0 MAIGLPSSLAKQILRRTGSGSSKSSSRFQDVPKGFLAVYVGEALQRKRFVVPMSYLSQPLFQDLLSMAEEEFGFDHPMGGLTIPCSEETFIAATSSLTRL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025911 [exp]	0	1
AT3G24140	bHLH	bHLH097, FMA	FAMA, basic helix-loop-helix (...		Lus10016680 [exp]	1.4	0.9006
AT4G34770			SAUR-like auxin-responsive pro...		Lus10038192 [exp]	1.7	0.9069
AT4G34770			SAUR-like auxin-responsive pro...		Lus10025909 [exp]	4.6	0.8828
AT5G48930		HCT	hydroxycinnamoyl-CoA shikimate...		Lus10037266 [exp]	6.3	0.8616
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008999 [exp]	6.3	0.8653
AT1G74160			unknown protein		Lus10021148 [exp]	6.6	0.8761
AT3G29030		ATEXP5, ATHEXPA...	ARABIDOPSIS THALIANA EXPANSIN ...		Lus10033011 [exp]	6.9	0.8648
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10008897 [exp]	7.7	0.8423
AT4G38840			SAUR-like auxin-responsive pro...		Lus10008995 [exp]	7.7	0.8556
AT1G75900		EXL3	GDSL-like Lipase/Acylhydrolase...		Lus10034540 [exp]	8.5	0.8593

Compare expression of checked genes

Lus10025911 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.