Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038188 [exp] 45 / 4e-07 AT3G07190 265 / 1e-90 B-cell receptor-associated protein 31-like (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025914 pacid=23177481 polypeptide=Lus10025914 locus=Lus10025914.g ID=Lus10025914.BGIv1.0 annot-version=v1.0 ATGTCAGCACTGTCAGAAGATGTGAAGAAGCTGAAGTTGGAAACAGAAGAAAAGGATAAGAAAGTTGAAACTACAGAAGCACATGCTACAGCCCTGCAAA AGCAATCTGCAGATCTGTTGCTTGAGTATGACCGGTTGCTTGAAGACAACCAAAACCTACAGGCTCAACAAGCACTAGGATACAAGCGTTGA
AA sequence Show only first row Show all	>Lus10025914 pacid=23177481 polypeptide=Lus10025914 locus=Lus10025914.g ID=Lus10025914.BGIv1.0 annot-version=v1.0 MSALSEDVKKLKLETEEKDKKVETTEAHATALQKQSADLLLEYDRLLEDNQNLQAQQALGYKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07190			B-cell receptor-associated pro...		Lus10025914 [exp]	0	1
AT2G27030		CAM5, CAM2, ACA...	calmodulin 5 (.1.2.3)		Lus10010386 [exp]	1.7	0.8799
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10006596 [exp]	4.5	0.8613
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011717 [exp]	4.7	0.8744
AT5G23540			Mov34/MPN/PAD-1 family protein...		Lus10011716 [exp]	4.9	0.8656
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Lus10010371 [exp]	5.7	0.8361
AT2G20020		CAF1, ATCAF1	RNA-binding CRS1 / YhbY (CRM) ...		Lus10034952 [exp]	6.3	0.8574
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	7.3	0.8532
AT5G62810		ATPEX14, PED2, ...	PEROXISOME DEFECTIVE 2, peroxi...		Lus10039935 [exp]	7.9	0.8531
AT5G56440			F-box/RNI-like/FBD-like domain...		Lus10023425 [exp]	13.5	0.7881
AT1G49480	B3	REM19, RTV1	related to vernalization1 1 (....		Lus10009214 [exp]	14.0	0.7800

Compare expression of checked genes

Lus10025914 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.