Lus10025931 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G07090 308 / 1e-106 PPPDE putative thiol peptidase family protein (.1)
AT2G25190 57 / 1e-09 PPPDE putative thiol peptidase family protein (.1)
AT5G25170 56 / 3e-09 PPPDE putative thiol peptidase family protein (.1)
AT4G17486 55 / 6e-09 PPPDE putative thiol peptidase family protein (.1.2)
AT4G31980 55 / 2e-08 unknown protein
AT5G47310 52 / 9e-08 PPPDE putative thiol peptidase family protein (.1)
AT1G47740 51 / 2e-07 PPPDE putative thiol peptidase family protein (.1.2)
AT4G25680 49 / 7e-07 PPPDE putative thiol peptidase family protein (.1)
AT4G25660 46 / 7e-06 PPPDE putative thiol peptidase family protein (.1)
AT1G80690 45 / 1e-05 PPPDE putative thiol peptidase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10038168 434 / 5e-156 AT3G07090 369 / 3e-130 PPPDE putative thiol peptidase family protein (.1)
Lus10043293 59 / 2e-10 AT4G17486 243 / 3e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10019437 59 / 5e-10 AT4G17486 241 / 1e-80 PPPDE putative thiol peptidase family protein (.1.2)
Lus10005341 58 / 6e-10 AT5G25170 303 / 9e-106 PPPDE putative thiol peptidase family protein (.1)
Lus10041021 57 / 1e-09 AT5G25170 309 / 5e-108 PPPDE putative thiol peptidase family protein (.1)
Lus10013657 57 / 1e-09 AT4G17486 243 / 1e-81 PPPDE putative thiol peptidase family protein (.1.2)
Lus10018326 54 / 8e-09 AT5G25170 314 / 3e-110 PPPDE putative thiol peptidase family protein (.1)
Lus10017127 54 / 2e-08 AT5G25170 312 / 3e-109 PPPDE putative thiol peptidase family protein (.1)
Lus10040170 53 / 3e-08 AT4G17486 283 / 9e-98 PPPDE putative thiol peptidase family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G241700 318 / 7e-110 AT3G07090 366 / 1e-128 PPPDE putative thiol peptidase family protein (.1)
Potri.001G154400 59 / 2e-10 AT5G47310 308 / 4e-107 PPPDE putative thiol peptidase family protein (.1)
Potri.003G080300 59 / 2e-10 AT5G47310 295 / 9e-102 PPPDE putative thiol peptidase family protein (.1)
Potri.006G154400 57 / 1e-09 AT4G17486 220 / 8e-73 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G070600 56 / 2e-09 AT4G17486 235 / 1e-78 PPPDE putative thiol peptidase family protein (.1.2)
Potri.006G261500 55 / 6e-09 AT5G25170 313 / 5e-109 PPPDE putative thiol peptidase family protein (.1)
Potri.002G134200 54 / 1e-08 AT1G47740 346 / 3e-121 PPPDE putative thiol peptidase family protein (.1.2)
Potri.018G021700 54 / 2e-08 AT5G25170 301 / 2e-104 PPPDE putative thiol peptidase family protein (.1)
Potri.009G113168 52 / 8e-08 AT1G47740 335 / 6e-117 PPPDE putative thiol peptidase family protein (.1.2)
Potri.T126004 51 / 1e-07 AT1G47740 337 / 2e-117 PPPDE putative thiol peptidase family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0125 Peptidase_CA PF05903 Peptidase_C97 PPPDE putative peptidase domain
Representative CDS sequence
>Lus10025931 pacid=23177589 polypeptide=Lus10025931 locus=Lus10025931.g ID=Lus10025931.BGIv1.0 annot-version=v1.0
ATGGAAGAAGCTTATTCCGAACTCCCCCAGGTTTTCGATCTGCATACTGGGGTGTCAGTGTACGGAAACGAATACTACTTTGGGGGAGGGATACAAAAGG
ACACAGCCGGAAGGACTCCATATGGAACTCCCCTCAAAGTAATCGAGCTGGGAGTAACGCATGTGCCCCAGGATGTATTTGAAATGTATTTGGATGAGAT
TAGCTCTCGATATACCGCTGAAACCTACAGTTTACTCAAACACAATTGTAACAATTTTAGCAACGAGGTTGCACAGTTTTTGGTCGGAGCATCCATTCCG
GATTACATTCTTCAGCTTCCTAATGAAGTTTTGAGCAGTCCGATGGGCTCTCTCATATTGCCCATGATACAGAATCTAGAGGCGACAATGAGAGCTGGGG
CTGTACCGCAAGTACCGCAATTCAGGCCTACTGTGGCCAGTCAGCAAACATTGGCTAGCAATGGAGCTGCATCATCCGGTAATTCAGGAGAGAAGAAGCC
ATCTGTGAACTCCGTGCCTCCTGCTGTTGAGCCCACAAAAGAGAAGGAGAAAGCTTCGCCTTCTGCGGCTGATCCTCTTGGAGATGCAAGAAGCAAAGTG
CAGGAAGAGATCGGTAGAGAATTTGCTGCGATCATGGCTCAGGGATCCCTGCGGGCAAGTGAGGCTGCTGCTCTTGCGACGAGGAGAGTGATGCAGAGAT
ATGGGAGTCTGAATGTTGGATCGCCTCGTAGTTAA
AA sequence
>Lus10025931 pacid=23177589 polypeptide=Lus10025931 locus=Lus10025931.g ID=Lus10025931.BGIv1.0 annot-version=v1.0
MEEAYSELPQVFDLHTGVSVYGNEYYFGGGIQKDTAGRTPYGTPLKVIELGVTHVPQDVFEMYLDEISSRYTAETYSLLKHNCNNFSNEVAQFLVGASIP
DYILQLPNEVLSSPMGSLILPMIQNLEATMRAGAVPQVPQFRPTVASQQTLASNGAASSGNSGEKKPSVNSVPPAVEPTKEKEKASPSAADPLGDARSKV
QEEIGREFAAIMAQGSLRASEAAALATRRVMQRYGSLNVGSPRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G07090 PPPDE putative thiol peptidase... Lus10025931 0 1
AT2G20560 DNAJ heat shock family protein... Lus10017687 1.0 0.9458
AT3G44110 ATJ3 DNAJ homologue 3 (.1.2) Lus10013364 2.0 0.9334
AT3G48690 ATCXE12 ARABIDOPSIS THALIANA CARBOXYES... Lus10027909 2.4 0.9128
AT2G23090 Uncharacterised protein family... Lus10014734 5.3 0.8371
AT5G22060 ATJ2 ARABIDOPSIS THALIANA DNAJ HOMO... Lus10004109 6.6 0.8865
AT5G47120 ATBI-1, ATBI1 ARABIDOPSIS BAX INHIBITOR 1, B... Lus10011006 6.7 0.8735
AT1G08830 CSD1 copper/zinc superoxide dismuta... Lus10001719 7.1 0.8496
AT5G42820 C3HZnF ATU2AF35B Zinc finger C-x8-C-x5-C-x3-H t... Lus10009389 7.5 0.8555
AT1G02840 ATSRP34, SR1, S... Serine/Arginine-Rich Protein S... Lus10029885 7.5 0.8605
AT5G04410 NAC NAC2, ANAC078 Arabidopsis NAC domain contain... Lus10017458 8.1 0.8685

Lus10025931 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.