Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1) AT5G04350 60 / 2e-12 Plant self-incompatibility protein S1 family (.1) AT4G29035 57 / 6e-11 Plant self-incompatibility protein S1 family (.1) AT4G16295 57 / 6e-11 SPH1 S-protein homologue 1 (.1) AT3G17080 56 / 1e-10 Plant self-incompatibility protein S1 family (.1) AT1G11765 54 / 4e-10 Plant self-incompatibility protein S1 family (.1) AT5G04347 53 / 7e-10 Plant self-incompatibility protein S1 family (.1) AT3G16970 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) AT4G16195 53 / 1e-09 Plant self-incompatibility protein S1 family (.1) AT5G27238 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10038163 [exp] 270 / 3e-95 AT3G26880 65 / 3e-14 Plant self-incompatibility protein S1 family (.1) Lus10025937 [exp] 273 / 2e-94 AT3G26880 68 / 4e-14 Plant self-incompatibility protein S1 family (.1) Lus10038164 [exp] 263 / 4e-92 AT3G26880 68 / 2e-15 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 86 / 3e-22 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10022831 [exp] 79 / 1e-19 AT2G06090 63 / 2e-13 Plant self-incompatibility protein S1 family (.1) Lus10011892 [exp] 74 / 2e-17 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1) Lus10011895 [exp] 74 / 2e-17 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1) Lus10022824 [exp] 74 / 2e-17 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1) Lus10002747 [exp] 72 / 3e-17 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 72 / 7e-17 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 68 / 4e-15 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.004G199700 [exp] 66 / 2e-14 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.010G008300 [exp] 65 / 2e-14 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.006G170200 [exp] 54 / 1e-09 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 50 / 1e-08 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.003G201300 [exp] 48 / 1e-07 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.004G199801 [exp] 47 / 4e-07 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1) Potri.001G053300 [exp] 45 / 1e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 44 / 1e-06 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10025935 pacid=23177670 polypeptide=Lus10025935 locus=Lus10025935.g ID=Lus10025935.BGIv1.0 annot-version=v1.0 ATGGCAGTGATTTTGGGAGCAATAGTAACTGCAAGTCCATCTGCGGCAACGCATTTTGACATCAATGTTATCAACCAGTTAAGCCACGACCGCAAACTGT CAGTTCACTGCCAATCTAAAGACACCAATCTCGGCTCCCGGAAATTAGCCGTCGGTGAAGTTTATGGATGGGGCTTCTCCAGAAACATATTTGGTACTAC TCTTTTCTGGTGCAATCTTTCTTGTCACGGTGGTCATAATCGCCTTTCGTTCAACGCGTACGATGAAAGCCAAGGAAAGGGCATGAAACCAATCTATGAA CTCAACTGGGAACTCAAGGATGATGGCCTTTATTTCCACGACAAAGATTCTGGCATGGAAGTTATGGTTGCTCCATGGATGCAGCAGTAG
AA sequence Show only first row Show all	>Lus10025935 pacid=23177670 polypeptide=Lus10025935 locus=Lus10025935.g ID=Lus10025935.BGIv1.0 annot-version=v1.0 MAVILGAIVTASPSAATHFDINVINQLSHDRKLSVHCQSKDTNLGSRKLAVGEVYGWGFSRNIFGTTLFWCNLSCHGGHNRLSFNAYDESQGKGMKPIYE LNWELKDDGLYFHDKDSGMEVMVAPWMQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G26880			Plant self-incompatibility pro...		Lus10025935 [exp]	0	1
AT5G24090		ATCHIA	chitinase A (.1)		Lus10037985 [exp]	1.0	0.8383
					Lus10002746 [exp]	6.5	0.7388
AT2G28380		DRB2	dsRNA-binding protein 2 (.1)		Lus10003362 [exp]	7.2	0.7675
					Lus10039884 [exp]	7.4	0.6705
AT1G71450	AP2_ERF		Integrase-type DNA-binding sup...		Lus10006173 [exp]	11.3	0.7217
AT1G13970			Protein of unknown function (D...		Lus10030425 [exp]	12.0	0.7510
AT1G17180		ATGSTU25	glutathione S-transferase TAU ...		Lus10035304 [exp]	15.2	0.7590
AT2G26150	HSF	ATHSFA2	heat shock transcription facto...		Lus10027627 [exp]	16.6	0.7281
AT1G66230	MYB	ATMYB20	myb domain protein 20 (.1)		Lus10004043 [exp]	16.9	0.7511
AT3G56950		SIP2;1, SIP2	small and basic intrinsic prot...		Lus10027275 [exp]	20.1	0.7257

Compare expression of checked genes

Lus10025935 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.