Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G39493 40 / 5e-05 Plant self-incompatibility protein S1 family (.1) AT5G04350 39 / 0.0001 Plant self-incompatibility protein S1 family (.1) AT4G24973 38 / 0.0004 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022824 [exp] 44 / 4e-06 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1) Lus10022831 [exp] 43 / 8e-06 AT2G06090 63 / 2e-13 Plant self-incompatibility protein S1 family (.1) Lus10011895 [exp] 42 / 2e-05 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1) Lus10002747 [exp] 40 / 5e-05 AT5G04350 57 / 3e-11 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 40 / 9e-05 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10039546 [exp] 40 / 0.0001 AT4G16295 56 / 3e-10 S-protein homologue 1 (.1) Lus10021633 [exp] 39 / 0.0002 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10016171 [exp] 39 / 0.0002 AT5G04347 54 / 7e-10 Plant self-incompatibility protein S1 family (.1) Lus10042506 [exp] 39 / 0.0003 AT4G16295 112 / 5e-32 S-protein homologue 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 44 / 4e-06 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 42 / 2e-05 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.002G252500 [exp] 42 / 2e-05 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10025936 pacid=23177466 polypeptide=Lus10025936 locus=Lus10025936.g ID=Lus10025936.BGIv1.0 annot-version=v1.0 ATGATACATATGCAGCAGAACCCACAACACAAACATCACAGGGAAAAGGGAATTAAGGCTGCGGCAAAGGGAAGTTCGATGAGGATGATGTCAAAAATAC TAGTGGCAGTGATTCTGGGAGCAATAGTAACGGCGAGTCCATCGGCGGCAACGCATTTTGACATCAATGTTATCAACCAGTTAAGCCACGACCGCAAGCT ATCAGTTCACTGCCAATCTAAGGACACCAATCTCGGCTCCCGGAAACTAGCCGTCGGCGAAGATAATAAAAGGCGAAGTTTATGGATGGGGCTTCTCCAG AAACATTTTTGGCACTACACTTTTCTGGTGCAATCTTTCTTGTCACGGTGGTCACAATCGTCTTTCGTTCAATGCGTACGATGA
AA sequence Show only first row Show all	>Lus10025936 pacid=23177466 polypeptide=Lus10025936 locus=Lus10025936.g ID=Lus10025936.BGIv1.0 annot-version=v1.0 MIHMQQNPQHKHHREKGIKAAAKGSSMRMMSKILVAVILGAIVTASPSAATHFDINVINQLSHDRKLSVHCQSKDTNLGSRKLAVGEDNKRRSLWMGLLQ KHFWHYTFLVQSFLSRWSQSSFVQCVR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025936 [exp]	0	1
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10036465 [exp]	2.2	0.8573
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10021655 [exp]	8.1	0.8213
AT1G14690		MAP65-7	microtubule-associated protein...		Lus10035098 [exp]	11.0	0.8146
AT1G78380		GST8, ATGSTU19	GLUTATHIONE TRANSFERASE 8, A. ...		Lus10042470 [exp]	15.8	0.7946
AT5G53970		TAT7	tyrosine aminotransferase 7, T...		Lus10033660 [exp]	16.6	0.7680
AT3G02875		ILR1	IAA-LEUCINE RESISTANT 1, Pepti...		Lus10029434 [exp]	18.6	0.6994
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10013128 [exp]	19.3	0.7284
AT2G36840		ACR10	ACT domain repeats 10, ACT-lik...		Lus10005447 [exp]	22.1	0.7707
AT4G04480			unknown protein		Lus10015548 [exp]	22.1	0.7261
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Lus10029809 [exp]	22.9	0.7962

Compare expression of checked genes

Lus10025936 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.