Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G62680 154 / 3e-44 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12700 152 / 3e-43 RPF1 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) AT3G22470 151 / 5e-43 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G12300 151 / 5e-43 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63630 144 / 5e-43 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT1G63150 150 / 2e-42 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G63230 144 / 2e-42 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G12775 149 / 3e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G63400 148 / 4e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G16640 146 / 8e-42 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009201 [exp] 286 / 5e-98 AT1G12700 274 / 3e-86 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10003427 [exp] 284 / 3e-96 AT1G12700 291 / 8e-92 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014245 [exp] 281 / 2e-92 AT1G12700 427 / 5e-141 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10014247 [exp] 280 / 3e-92 AT1G62930 340 / 3e-109 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10014244 [exp] 278 / 2e-91 AT1G12700 397 / 7e-130 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10022861 [exp] 252 / 1e-81 AT1G12700 370 / 7e-121 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Lus10024962 [exp] 249 / 7e-81 AT1G62680 346 / 3e-113 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10003429 [exp] 227 / 3e-75 AT1G62930 173 / 1e-49 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10008593 [exp] 236 / 5e-75 AT1G12700 400 / 7e-131 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G034300 [exp] 184 / 2e-56 AT1G62930 397 / 4e-133 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.013G034400 [exp] 183 / 9e-55 AT3G22470 476 / 1e-161 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.005G038400 [exp] 182 / 2e-54 AT1G12700 478 / 7e-161 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G034200 [exp] 181 / 3e-54 AT1G12700 511 / 6e-174 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.019G021200 [exp] 181 / 4e-54 AT1G12700 491 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.005G046200 [exp] 179 / 3e-53 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.013G149800 [exp] 179 / 3e-53 AT1G12700 482 / 6e-162 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1) Potri.017G032100 [exp] 177 / 3e-53 AT1G62930 451 / 2e-152 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.006G242200 [exp] 178 / 4e-53 AT1G62930 472 / 4e-160 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G074700 [exp] 175 / 1e-52 AT1G62930 481 / 1e-164 RNA processing factor 3, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10025942 pacid=23173122 polypeptide=Lus10025942 locus=Lus10025942.g ID=Lus10025942.BGIv1.0 annot-version=v1.0 ATGAAGGATAGAAAATGTTCACCAAATGTTGTTAGTTACAGTTGTTTGATTCATGGTTTATGTGCTTCAAGTCGGAAGAATGAAGCTATATTGTTGTTTG GCAATATGTTAGAGATGAATGTCATTCCTAATGTAGTCACCTATAACATTCTGATTGATTCTTTTTGCAAAGATGGAATGGTCCGTGAGGCTAAAGCTAT AGTCAAAGTGATGATTCAAAAAGGACAGCATCCGGATATCATTACTTACAATTCATTTCTAGATTGGTATTGTTTGCGTTATGAAATAGACAAAGCTCGT AACTTGTTTAATTCTTTAGTTAGCATGGAATGCGAGCCTGACGCTTATACTTATAGTACCATGATTAATGGATATTGTAAGAGTGAAAGGTTGACTGAAG CCAAACAGTTATTCAATGATATGCTTCAGAAGGATTTAGCTCCGGACACTGTTACGTATTCTGTTCTTATGGCTGGGTTTTGCCGAGCAGGAAAGTTACA GATGCAGAAACACTTCTTAAGGAAATGTGCAATCGGGGACACTTTCCTGATATCGTGA
AA sequence Show only first row Show all	>Lus10025942 pacid=23173122 polypeptide=Lus10025942 locus=Lus10025942.g ID=Lus10025942.BGIv1.0 annot-version=v1.0 MKDRKCSPNVVSYSCLIHGLCASSRKNEAILLFGNMLEMNVIPNVVTYNILIDSFCKDGMVREAKAIVKVMIQKGQHPDIITYNSFLDWYCLRYEIDKAR NLFNSLVSMECEPDAYTYSTMINGYCKSERLTEAKQLFNDMLQKDLAPDTVTYSVLMAGFCRAGKLQMQKHFLRKCAIGDTFLIS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G62680			Pentatricopeptide repeat (PPR)...		Lus10025942 [exp]	0	1
AT3G55510		RBL	REBELOTE, Noc2p family (.1)		Lus10026968 [exp]	3.0	0.8496
AT5G07940			unknown protein		Lus10034693 [exp]	13.3	0.7947
AT5G60040		NRPC1	nuclear RNA polymerase C1 (.1....		Lus10000051 [exp]	14.3	0.8162
AT2G02750			Pentatricopeptide repeat (PPR)...		Lus10013264 [exp]	17.1	0.8144
AT3G26540			Tetratricopeptide repeat (TPR)...		Lus10015584 [exp]	18.1	0.8403
AT5G55540		LOP1, TRN1	LOPPED 1, tornado 1 (.1)		Lus10003767 [exp]	20.6	0.8280
AT4G00020		BRCA2(IV), BRCA...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10017786 [exp]	24.4	0.7680
AT3G47570			Leucine-rich repeat protein ki...		Lus10038598 [exp]	33.5	0.7984
AT3G49990			unknown protein		Lus10015447 [exp]	33.9	0.7903
AT3G08960			ARM repeat superfamily protein...		Lus10008367 [exp]	34.6	0.7421

Compare expression of checked genes

Lus10025942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.