Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04300 129 / 6e-40 RmlC-like cupins superfamily protein (.1) AT4G28703 129 / 8e-40 RmlC-like cupins superfamily protein (.1) AT4G10300 123 / 3e-37 RmlC-like cupins superfamily protein (.1) AT4G10280 74 / 6e-18 RmlC-like cupins superfamily protein (.1) AT4G10290 67 / 2e-15 RmlC-like cupins superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014252 [exp] 197 / 1e-66 AT4G28703 133 / 1e-41 RmlC-like cupins superfamily protein (.1) Lus10035659 [exp] 115 / 1e-33 AT4G10300 175 / 5e-57 RmlC-like cupins superfamily protein (.1) Lus10037245 [exp] 99 / 5e-27 AT4G10300 149 / 8e-47 RmlC-like cupins superfamily protein (.1) Lus10035660 [exp] 96 / 9e-26 AT4G10300 147 / 5e-46 RmlC-like cupins superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G254800 [exp] 157 / 4e-51 AT3G04300 143 / 8e-46 RmlC-like cupins superfamily protein (.1) Potri.013G089600 [exp] 116 / 5e-34 AT4G10300 171 / 1e-55 RmlC-like cupins superfamily protein (.1) Potri.014G156900 [exp] 44 / 4e-06 AT2G32650 203 / 2e-68 RmlC-like cupins superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF05899 [flax] [poplar] Cupin_3 Protein of unknown function (DUF861)
Representative CDS sequence Show only first row Show all	>Lus10025947 pacid=23173254 polypeptide=Lus10025947 locus=Lus10025947.g ID=Lus10025947.BGIv1.0 annot-version=v1.0 ATGAGCGATGAGCAGAGGCTGAGAATCAGCGTGGAGAGGAACCCTTCAGAAGCCAAGCTCAAGGAATTAAACTTCAAGAGTTGGCCCAAGTGGGGGTGTT CGCCGGGAAAGTACCAGCTGAAATTCGACGCGGAGGAGACTTGCTATTTGGTCAAAGGGAAAGTCAAAGTCTTTCCGAAAAGCGGAGGAGAGCAGTCAAC GTCGGAGTATGTAGAGTTCGGCGCCGGAGATCTGGTGGTGATTCCGAAGGGAATGAGCTGTACGTGGGATGTAACTGTCGCCGTGGACAAATACTACAAG TTTGAGTCGTCGTCGTTTGCTTCTTCTTCTTCTTCTTCGCCGCCGCCGCCGCCGAGAGCTCCTCCTTCTGGTAGCTGGCCTAGCTAA
AA sequence Show only first row Show all	>Lus10025947 pacid=23173254 polypeptide=Lus10025947 locus=Lus10025947.g ID=Lus10025947.BGIv1.0 annot-version=v1.0 MSDEQRLRISVERNPSEAKLKELNFKSWPKWGCSPGKYQLKFDAEETCYLVKGKVKVFPKSGGEQSTSEYVEFGAGDLVVIPKGMSCTWDVTVAVDKYYK FESSSFASSSSSSPPPPPRAPPSGSWPS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28703			RmlC-like cupins superfamily p...		Lus10025947 [exp]	0	1
AT4G28703			RmlC-like cupins superfamily p...		Lus10014252 [exp]	8.2	0.7409
AT5G01370		ACI1	ALC-interacting protein 1 (.1)		Lus10002480 [exp]	11.3	0.6718
AT1G30320			Remorin family protein (.1)		Lus10038522 [exp]	11.4	0.6614
AT5G02800		CDL1	CDG1-like 1, Protein kinase su...		Lus10015050 [exp]	12.0	0.6427
AT5G42520	BBR_BPC	BPC6, BBR/BPC6,...	ARABIDOPSIS THALIANA BASIC PEN...		Lus10024313 [exp]	15.5	0.6518
AT1G64970		VTE4, TMT1, G-T...	VITAMIN E DEFICIENT 4, gamma-t...		Lus10020357 [exp]	23.2	0.6453
					Lus10033126 [exp]	32.2	0.6536
AT5G53130		ATCNGC1, CNGC1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10019014 [exp]	34.1	0.6362
AT1G13510			Protein of unknown function (D...		Lus10031915 [exp]	39.1	0.6011
AT1G11340			S-locus lectin protein kinase ...		Lus10017247 [exp]	40.7	0.5935

Compare expression of checked genes

Lus10025947 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.