Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17660 87 / 1e-24 RPM1-interacting protein 4 (RIN4) family protein (.1) AT4G35655 79 / 2e-21 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G55850 76 / 7e-20 NOI RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) AT5G40645 75 / 1e-19 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G63270 74 / 4e-19 RPM1-interacting protein 4 (RIN4) family protein (.1) AT2G04410 68 / 7e-17 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G48450 61 / 8e-14 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G25070 51 / 2e-09 RIN4 RPM1 interacting protein 4 (.1) AT5G19473 35 / 0.0006 RPM1-interacting protein 4 (RIN4) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10012316 [exp] 77 / 3e-20 AT5G55850 87 / 4e-24 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10022524 [exp] 76 / 7e-20 AT2G04410 104 / 2e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10016623 [exp] 73 / 8e-19 AT2G04410 105 / 1e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10032112 [exp] 71 / 2e-17 AT5G55850 80 / 1e-20 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10006361 [exp] 66 / 4e-16 AT5G55850 73 / 7e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10014574 [exp] 63 / 6e-15 AT5G55850 76 / 1e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10040889 [exp] 50 / 4e-09 AT1G53000 147 / 6e-44 CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1) Lus10036939 [exp] 49 / 7e-09 AT3G25070 52 / 7e-10 RPM1 interacting protein 4 (.1) Lus10006250 [exp] 49 / 7e-09 AT5G55850 52 / 7e-10 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G338500 [exp] 76 / 4e-20 AT5G40645 82 / 1e-22 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.001G368900 [exp] 74 / 4e-19 AT5G55850 124 / 4e-39 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.011G094200 [exp] 74 / 1e-18 AT5G55850 123 / 8e-38 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.014G168900 [exp] 72 / 2e-18 AT2G04410 102 / 1e-30 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.015G089201 [exp] 70 / 1e-17 AT2G04410 90 / 1e-25 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.012G092601 [exp] 66 / 1e-15 AT2G04410 78 / 3e-20 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.002G245400 [exp] 53 / 1e-09 AT3G25070 169 / 3e-52 RPM1 interacting protein 4 (.1) Potri.011G022000 [exp] 50 / 7e-09 AT3G25070 74 / 6e-16 RPM1 interacting protein 4 (.1) Potri.004G002500 [exp] 47 / 6e-08 AT3G25070 75 / 1e-16 RPM1 interacting protein 4 (.1) Potri.009G067600 [exp] 35 / 0.0008 AT5G19473 98 / 5e-28 RPM1-interacting protein 4 (RIN4) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05627 [flax] [poplar] AvrRpt-cleavage Cleavage site for pathogenic type III effector avirulence factor Avr
Representative CDS sequence Show only first row Show all	>Lus10025949 pacid=23173211 polypeptide=Lus10025949 locus=Lus10025949.g ID=Lus10025949.BGIv1.0 annot-version=v1.0 ATGGCGACGGAGGAGAAAGGAAGGGCTCTGCCAAAATTCGGGGAGTGGGACGTTAATGATCCGACGACGGCAGAAGGATTCACGGTGATATTCACCAAGG CAAGAGACGAGAAGAAGAACGGCCCGTCCACCGGCGCCGGAGCTGCTAACGACAAGAGGCGCGACGACCAAAAGGCCGGTAAACCTTCTACCAAGAGATG GCTGTGCTTTACGTTTGAAGAGCGCTGA
AA sequence Show only first row Show all	>Lus10025949 pacid=23173211 polypeptide=Lus10025949 locus=Lus10025949.g ID=Lus10025949.BGIv1.0 annot-version=v1.0 MATEEKGRALPKFGEWDVNDPTTAEGFTVIFTKARDEKKNGPSTGAGAANDKRRDDQKAGKPSTKRWLCFTFEER

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G17660			RPM1-interacting protein 4 (RI...		Lus10025949 [exp]	0	1
AT2G32030			Acyl-CoA N-acyltransferases (N...		Lus10024705 [exp]	11.2	0.6928
					Lus10023025 [exp]	27.0	0.7264
AT1G09480			NAD(P)-binding Rossmann-fold s...		Lus10016389 [exp]	29.5	0.7408
AT3G10230		AtLCY, LYC	lycopene cyclase (.1.2)		Lus10005190 [exp]	41.4	0.6851
					Lus10002730 [exp]	48.7	0.6688
AT2G23540			GDSL-like Lipase/Acylhydrolase...		Lus10016918 [exp]	160.9	0.6530

Compare expression of checked genes

Lus10025949 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.