Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G35890 44 / 3e-06 winged-helix DNA-binding transcription factor family protein (.1) AT5G66100 40 / 4e-05 winged-helix DNA-binding transcription factor family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014254 [exp] 127 / 3e-36 AT4G35890 246 / 6e-76 winged-helix DNA-binding transcription factor family protein (.1) Lus10025953 [exp] 119 / 2e-33 AT4G35890 226 / 8e-69 winged-helix DNA-binding transcription factor family protein (.1) Lus10025951 [exp] 119 / 5e-33 AT4G35890 264 / 4e-82 winged-helix DNA-binding transcription factor family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G063600 [exp] 79 / 2e-18 AT4G35890 165 / 1e-44 winged-helix DNA-binding transcription factor family protein (.1) Potri.005G109400 [exp] 78 / 2e-18 AT4G35890 178 / 2e-49 winged-helix DNA-binding transcription factor family protein (.1) Potri.005G243600 [exp] 47 / 2e-07 AT5G66100 109 / 1e-25 winged-helix DNA-binding transcription factor family protein (.1) Potri.009G018100 [exp] 42 / 8e-06 AT5G21160 660 / 0.0 LA RNA-binding protein (.1.2.3) Potri.001G220100 [exp] 38 / 0.0004 AT5G21160 607 / 0.0 LA RNA-binding protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025954 pacid=23173220 polypeptide=Lus10025954 locus=Lus10025954.g ID=Lus10025954.BGIv1.0 annot-version=v1.0 ATGCGAACAACGAGCAAACTCGTTTCGCAACTGACAGATAGTATTCCACTGATATTGGATGCTTTAAGGAGTTCTTCCATTGTGGTGGAAGTGCAGGGTG ACAAAGTAAGACGATGGACCGACCGGATGAGGTGGTTGTTGCGAACATCTCAGTTCCCAACTGCTACAAGTCCTCGGGGACTCGGGGAGTCCAGTAGTCA AGACATGATCTCCGATAAAGTGCAGAACTTGTCTTTGGAAGAGAAGGTGACTGGGCAGAGCCAAAGTACATCTTAA
AA sequence Show only first row Show all	>Lus10025954 pacid=23173220 polypeptide=Lus10025954 locus=Lus10025954.g ID=Lus10025954.BGIv1.0 annot-version=v1.0 MRTTSKLVSQLTDSIPLILDALRSSSIVVEVQGDKVRRWTDRMRWLLRTSQFPTATSPRGLGESSSQDMISDKVQNLSLEEKVTGQSQSTS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025954 [exp]	0	1
AT4G12560		CPR1, CPR30	CONSTITUTIVE EXPRESSER OF PR G...		Lus10000190 [exp]	3.5	0.8679
					Lus10024618 [exp]	5.3	0.8509
AT5G25190	AP2_ERF	ESE3	ethylene and salt inducible 3,...		Lus10041614 [exp]	5.7	0.7586
AT5G07480		KUOX1	KAR-UP oxidoreductase 1 (.1)		Lus10042999 [exp]	6.0	0.8160
AT1G63990		SPO11-2	sporulation 11-2 (.1)		Lus10024675 [exp]	7.7	0.8072
AT5G20610			unknown protein		Lus10025003 [exp]	9.5	0.7839
					Lus10008327 [exp]	10.4	0.7839
AT2G27110	FAR1_related	FRS3	FAR1-related sequence 3 (.1.2....		Lus10008762 [exp]	11.2	0.7839
					Lus10010697 [exp]	12.0	0.7839
AT4G13230			Late embryogenesis abundant pr...		Lus10022822 [exp]	12.7	0.7839

Compare expression of checked genes

Lus10025954 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.