Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014263 [exp] 139 / 1e-44 ND / Lus10041915 [exp] 58 / 9e-12 ND / Lus10034523 [exp] 37 / 0.0007 AT1G75717 45 / 1e-06 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G114500 [exp] 100 / 2e-28 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10025963 pacid=23173161 polypeptide=Lus10025963 locus=Lus10025963.g ID=Lus10025963.BGIv1.0 annot-version=v1.0 ATGAAGAGCAGCAGCATGTGTATTCCGAGGCTGAGAACCGCCGCCACGTGTTCAGTGAAGACCCACCGCGTCTCTCATCATCATCCGGTGTCCCTCCTCC ACCGTTTCCGGGAATCTGTCTTCCGCCTCATGATGATCTCCGCGGATACTTCTTCTTCTTCCTCCTCTTCAGATCGTCATCGGACGGTGAGAAGGGCGTC GTACCGCGGCTATCTAGCTGATCCTTACCACAGCGAAGCAGTGGCTGATTGCATAGAGTTCATTAAGAAGACGGCTATAACGGACGGCGACCACGAGGAA GAGGACGAGGCCAACGCCGTTATGCATGTCATGTGA
AA sequence Show only first row Show all	>Lus10025963 pacid=23173161 polypeptide=Lus10025963 locus=Lus10025963.g ID=Lus10025963.BGIv1.0 annot-version=v1.0 MKSSSMCIPRLRTAATCSVKTHRVSHHHPVSLLHRFRESVFRLMMISADTSSSSSSSDRHRTVRRASYRGYLADPYHSEAVADCIEFIKKTAITDGDHEE EDEANAVMHVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10025963 [exp]	0	1
AT2G43870			Pectin lyase-like superfamily ...		Lus10002124 [exp]	3.2	0.9654
AT1G53130		GRI	GRIM REAPER, Stigma-specific S...		Lus10005544 [exp]	3.5	0.9682
AT5G06490			RING/U-box superfamily protein...		Lus10008972 [exp]	7.5	0.9555
AT3G12120		FAD2	fatty acid desaturase 2 (.1.2)		Lus10021047 [exp]	7.7	0.9525
AT1G68150	WRKY	ATWRKY9, WRKY9	WRKY DNA-binding protein 9 (.1...		Lus10035971 [exp]	8.5	0.9601
AT1G04220		KCS2	3-ketoacyl-CoA synthase 2 (.1)		Lus10039399 [exp]	9.0	0.9619
AT4G00080		UNE11	unfertilized embryo sac 11, Pl...		Lus10030292 [exp]	9.9	0.9557
AT2G42850		CYP718	"cytochrome P450, family 718",...		Lus10010940 [exp]	10.0	0.9552
AT5G57090		MM31, ATPIN2, A...	WAVY ROOTS 6, ETHYLENE INSENSI...		Lus10001637 [exp]	14.1	0.9595
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10009992 [exp]	15.2	0.9528

Compare expression of checked genes

Lus10025963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.