Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59970 163 / 8e-54 Histone superfamily protein (.1) AT5G59690 163 / 8e-54 Histone superfamily protein (.1) AT3G46320 163 / 8e-54 Histone superfamily protein (.1) AT3G53730 163 / 8e-54 Histone superfamily protein (.1) AT3G45930 163 / 8e-54 Histone superfamily protein (.1) AT2G28740 163 / 8e-54 HIS4 histone H4 (.1) AT1G07820 163 / 8e-54 Histone superfamily protein (.1.2) AT1G07660 163 / 8e-54 Histone superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005448 [exp] 163 / 9e-54 AT2G28740 199 / 2e-68 histone H4 (.1) Lus10041919 [exp] 163 / 9e-54 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10019956 [exp] 163 / 9e-54 AT3G46320 199 / 2e-68 Histone superfamily protein (.1) Lus10040849 [exp] 163 / 9e-54 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10038481 [exp] 163 / 9e-54 AT3G53730 199 / 2e-68 Histone superfamily protein (.1) Lus10014264 [exp] 163 / 9e-54 AT5G59690 199 / 2e-68 Histone superfamily protein (.1) Lus10028464 [exp] 163 / 9e-54 AT5G59970 199 / 2e-68 Histone superfamily protein (.1) Lus10015492 [exp] 163 / 9e-54 AT1G07820 199 / 2e-68 Histone superfamily protein (.1.2) Lus10004949 [exp] 163 / 9e-54 AT3G53730 199 / 2e-68 Histone superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G047500 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013300 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G013500 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.007G012500 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.006G168100 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G214000 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.010G213900 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092900 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G093000 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1) Potri.018G092666 [exp] 163 / 8e-54 AT5G59970 162 / 1e-53 Histone superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0012 [flax] [poplar] Histone PF00125 [flax] [poplar] Histone Core histone H2A/H2B/H3/H4
Representative CDS sequence Show only first row Show all	>Lus10025964 pacid=23173127 polypeptide=Lus10025964 locus=Lus10025964.g ID=Lus10025964.BGIv1.0 annot-version=v1.0 ATGTCAGGAAGAGGCAAAGGGGGAAAGGGACTTGGAAAGGGAGGAGCCAAGAGGCACAGGAAGGTCTTGCGAGATAACATCCAGGGCATCACCAAGCCCG CCATCCGAAGACTCGCCCGCAGAGGTGGTGTCAAGCGTATCAGTGGCCTCATCTACGAGGAAACCAGAGGCGTTCTCAAGATCTTCCTCGAGAACGTCAT TCGCGATGCTGTCACCTACACTGAGCACGCTCGCAGGAAGACCGTCACCGCAATGGATGTCGTCTACGCCTTGAAGAGGCAGGGCCGTACCCTCTACGGT TTCGGTGGTTGA
AA sequence Show only first row Show all	>Lus10025964 pacid=23173127 polypeptide=Lus10025964 locus=Lus10025964.g ID=Lus10025964.BGIv1.0 annot-version=v1.0 MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYG FGG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G28740		HIS4	histone H4 (.1)		Lus10025964 [exp]	0	1
AT3G46320			Histone superfamily protein (....		Lus10019956 [exp]	1.7	0.9430
AT3G27360			Histone superfamily protein (....		Lus10031252 [exp]	2.0	0.9716
AT5G10400			Histone superfamily protein (....		Lus10031822 [exp]	2.0	0.9746
AT3G12170			Chaperone DnaJ-domain superfam...		Lus10042353 [exp]	4.1	0.9221
AT5G48870		SAD1	SUPERSENSITIVE TO ABA AND DROU...		Lus10022810 [exp]	5.7	0.9066
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10009538 [exp]	6.0	0.8972
AT5G23420		HMGB6	high-mobility group box 6 (.1....		Lus10013453 [exp]	6.3	0.9387
AT5G37010			unknown protein		Lus10031372 [exp]	6.5	0.9376
AT1G78650		POLD3	DNA-directed DNA polymerases (...		Lus10039192 [exp]	6.5	0.9241
AT5G49170			unknown protein		Lus10022872 [exp]	6.8	0.9148

Compare expression of checked genes

Lus10025964 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.