Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G15380 165 / 3e-52 GLYI4 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT1G80160 164 / 6e-52 GLYI7 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) AT2G28420 159 / 2e-49 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) AT5G57040 49 / 2e-07 Lactoylglutathione lyase / glyoxalase I family protein (.1) AT2G32090 47 / 5e-07 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014269 [exp] 332 / 8e-118 AT1G15380 166 / 2e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10014480 [exp] 159 / 9e-50 AT1G80160 244 / 1e-83 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10039579 [exp] 160 / 1e-49 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10005324 [exp] 159 / 2e-49 AT2G28420 245 / 2e-83 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10030070 [exp] 158 / 2e-49 AT1G80160 247 / 7e-85 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10017158 [exp] 48 / 7e-07 AT5G57040 254 / 7e-87 Lactoylglutathione lyase / glyoxalase I family protein (.1) Lus10006122 [exp] 44 / 7e-06 AT2G32090 199 / 3e-67 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10010552 [exp] 42 / 8e-05 AT2G32090 197 / 3e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Lus10016138 [exp] 40 / 0.0008 AT1G08110 302 / 2e-104 lactoylglutathione lyase family protein / glyoxalase I family protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G117000 [exp] 253 / 8e-87 AT1G80160 166 / 2e-52 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.007G015100 [exp] 246 / 5e-84 AT1G15380 167 / 7e-53 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.003G009000 [exp] 192 / 3e-62 AT1G80160 190 / 8e-62 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.004G223300 [exp] 181 / 4e-58 AT1G80160 187 / 1e-60 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.001G171600 [exp] 174 / 6e-56 AT1G80160 270 / 6e-94 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.003G062400 [exp] 173 / 2e-55 AT1G80160 261 / 2e-90 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.007G129200 [exp] 159 / 3e-50 AT1G80160 225 / 1e-76 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2) Potri.009G055500 [exp] 159 / 1e-49 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1) Potri.010G087000 [exp] 47 / 9e-07 AT2G32090 189 / 3e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0104 [flax] [poplar] Glyoxalase PF00903 [flax] [poplar] Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10025971 pacid=23173269 polypeptide=Lus10025971 locus=Lus10025971.g ID=Lus10025971.BGIv1.0 annot-version=v1.0 ATGGTGGAGGAGATAGAGGAAGTGAGAAGCTACAGCAGCAGCAGCAACAGGCAGGAGGCACTGCCACTGGTGTCACTGAATCATGTGTCGTTGATGTGCA GGTCGGTGTGGGAATCAACGAGGTTTTACGAGGACGTGATGGGATTTCTCCTCATTAAGCGTCCTTCTTCTTTCAACTTCACCGGCGCCTGGTTGTACAA TTATGGAATTGGGATACATCTGATTGAGAACACATCACTGGATACTGATCAATTCGAGCCGCGCCCGATCAACCCCAAAGACAACCACATTTCATTCCAA TGTACGGATGTGAAGGTGGTTCAGAGGAGGCTGGAGGAGTTGGGGATGAGATACGAGACAGCAGTGGTGGAGGATGACGAAGGGGCGAAAGCGGAACAAG TGTTCTTCCATGACCCAGATGGTTACATGCTCGAAATCTGCAACTGCGACAACATCCCGATCTTGCCCCTCTCGAGTTCCAAGAAATCTGTAGGAGGAGC AAAATGTGGGATGTTGCTGTTAATGGAGAATGAGATGATGGAGAATTTGAGCATGGATATCATGAACCTTGCCTTTTGA
AA sequence Show only first row Show all	>Lus10025971 pacid=23173269 polypeptide=Lus10025971 locus=Lus10025971.g ID=Lus10025971.BGIv1.0 annot-version=v1.0 MVEEIEEVRSYSSSSNRQEALPLVSLNHVSLMCRSVWESTRFYEDVMGFLLIKRPSSFNFTGAWLYNYGIGIHLIENTSLDTDQFEPRPINPKDNHISFQ CTDVKVVQRRLEELGMRYETAVVEDDEGAKAEQVFFHDPDGYMLEICNCDNIPILPLSSSKKSVGGAKCGMLLLMENEMMENLSMDIMNLAF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G15380		GLYI4	glyoxylase I 4, Lactoylglutath...		Lus10025971 [exp]	0	1
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10007348 [exp]	2.4	0.9086
AT1G64760			O-Glycosyl hydrolases family 1...		Lus10020526 [exp]	3.5	0.8628
AT3G23730		XTH16	xyloglucan endotransglucosylas...		Lus10020772 [exp]	5.7	0.8885
AT2G43020		ATPAO2	polyamine oxidase 2 (.1)		Lus10001044 [exp]	6.2	0.8476
AT5G60920		COB	COBRA-like extracellular glyco...		Lus10017861 [exp]	6.7	0.8830
AT4G27280			Calcium-binding EF-hand family...		Lus10033753 [exp]	6.9	0.8980
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10024263 [exp]	8.3	0.8929
					Lus10030316 [exp]	9.3	0.8299
AT5G16080		ATCXE17	carboxyesterase 17 (.1)		Lus10041632 [exp]	9.5	0.8499
AT3G45970		ATHEXPBETA2.1, ...	EXPANSIN L1, expansin-like A1 ...		Lus10022639 [exp]	10.4	0.8334

Compare expression of checked genes

Lus10025971 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.