Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G51030 168 / 2e-55 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G19730 125 / 3e-38 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G42980 124 / 7e-38 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1) AT1G45145 121 / 7e-37 LIV1, ATTRX5, ATH5 LOCUS OF INSENSITIVITY TO VICTORIN 1, thioredoxin H-type 5 (.1) AT5G39950 91 / 1e-24 ATTRXH2, ATTRX2, ATH2 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) AT3G17880 92 / 4e-23 ATHIP2, ATTDX HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) AT3G08710 86 / 1e-22 TRXH9, ATH9 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) AT3G56420 84 / 1e-21 Thioredoxin superfamily protein (.1) AT1G59730 79 / 7e-20 ATH7 thioredoxin H-type 7 (.1) AT1G69880 75 / 2e-18 ATH8 thioredoxin H-type 8 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014277 [exp] 214 / 8e-74 AT3G51030 185 / 4e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10041799 [exp] 179 / 7e-60 AT3G51030 182 / 8e-61 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10028349 [exp] 177 / 4e-59 AT3G51030 179 / 1e-59 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10024293 [exp] 131 / 9e-41 AT3G51030 162 / 4e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10000802 [exp] 130 / 2e-40 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Lus10005258 [exp] 95 / 3e-26 AT5G39950 189 / 4e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10030666 [exp] 95 / 3e-26 AT5G39950 189 / 3e-63 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Lus10022727 [exp] 93 / 4e-25 AT3G08710 189 / 6e-63 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Lus10014186 [exp] 93 / 4e-25 AT3G08710 192 / 3e-64 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G018000 [exp] 162 / 6e-53 AT3G51030 186 / 2e-62 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.005G232700 [exp] 128 / 1e-39 AT3G51030 162 / 5e-53 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.002G030000 [exp] 120 / 1e-36 AT3G51030 160 / 3e-52 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) Potri.012G045000 [exp] 104 / 5e-28 AT3G17880 379 / 4e-131 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.015G036000 [exp] 101 / 9e-27 AT3G17880 396 / 3e-137 HSC-70 INTERACTING PROTEIN, ARABIDOPSIS THALIANA HSP70-INTERACTING PROTEIN 2, tetraticopeptide domain-containing thioredoxin (.1.2) Potri.017G076700 [exp] 93 / 3e-25 AT5G39950 168 / 7e-55 Arabidopsis thioredoxin h2, thioredoxin 2 (.1) Potri.006G110100 [exp] 92 / 7e-25 AT3G08710 178 / 1e-58 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.016G138800 [exp] 84 / 1e-21 AT3G08710 208 / 1e-70 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2) Potri.008G194100 [exp] 83 / 2e-21 AT1G59730 119 / 3e-35 thioredoxin H-type 7 (.1) Potri.019G062000 [exp] 76 / 9e-19 AT3G08710 164 / 6e-53 THIOREDOXIN TYPE H 9, thioredoxin H-type 9 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10025979 pacid=23173204 polypeptide=Lus10025979 locus=Lus10025979.g ID=Lus10025979.BGIv1.0 annot-version=v1.0 ATGGCAGCGGAGGAAGGTCTGGTGTTTGGTTGCCATACCGTTGAAGATTGCGAGGCCCAGCTTCAGAAAGCTAACGAATCTAAGAAGCTGGTGGTTGTTG ATTTCACTGCGACATGGTGTGGGCCTTGCCGTTTGATGGCGCCATTCCTCGCAGAGCTTGCTAAGAAGCTTCCCACCGTTACCTTCCGCAAGGTCGATAC AGTTGCTGAGGATTGGGCTGTTGAGGCAATGCCAACGTTCATGTTTGTGAAAGATGGAAAGATACTTGACAGGGTGGTTGGTGCCAAGAAGGAAGAGCTG CAATATACTATCAACAAGTATTTGGCTACTGCCTCTGCTTGA
AA sequence Show only first row Show all	>Lus10025979 pacid=23173204 polypeptide=Lus10025979 locus=Lus10025979.g ID=Lus10025979.BGIv1.0 annot-version=v1.0 MAAEEGLVFGCHTVEDCEAQLQKANESKKLVVVDFTATWCGPCRLMAPFLAELAKKLPTVTFRKVDTVAEDWAVEAMPTFMFVKDGKILDRVVGAKKEEL QYTINKYLATASA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Lus10025979 [exp]	0	1
AT1G75130		CYP721A1	"cytochrome P450, family 721, ...		Lus10010821 [exp]	8.9	0.7028
AT3G46290		HERK1	hercules receptor kinase 1 (.1...		Lus10003312 [exp]	10.6	0.7305
AT3G10480	NAC	ANAC050	NAC domain containing protein ...		Lus10033676 [exp]	20.9	0.7030
AT3G08000			RNA-binding (RRM/RBD/RNP motif...		Lus10031534 [exp]	28.9	0.7060
AT5G44710			unknown protein		Lus10001221 [exp]	46.3	0.6294
					Lus10025864 [exp]	46.6	0.6295
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10013653 [exp]	47.4	0.6501
AT2G39170			unknown protein		Lus10018298 [exp]	58.0	0.6120
AT1G02810			Plant invertase/pectin methyle...		Lus10010309 [exp]	62.0	0.6635
AT3G54040			PAR1 protein (.1)		Lus10017196 [exp]	76.9	0.6430

Compare expression of checked genes

Lus10025979 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.