Lus10025982 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G44230 167 / 5e-49 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G57430 139 / 3e-38 OTP84 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G23330 135 / 4e-37 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G13770 131 / 8e-36 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G14850 129 / 3e-35 MEF11, LOI1 lovastatin insensitive 1, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G08820 129 / 4e-35 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G26782 128 / 9e-35 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G24000 126 / 5e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 126 / 6e-34 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G04780 125 / 1e-33 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10031989 142 / 2e-39 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10020743 138 / 3e-38 AT1G04840 771 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10016387 134 / 2e-37 AT4G33990 717 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10033026 134 / 7e-37 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010909 134 / 1e-36 AT5G66520 537 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10010998 132 / 4e-36 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10001220 131 / 1e-35 AT3G57430 1110 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10019735 131 / 1e-35 AT4G33990 1015 / 0.0 embryo defective 2758, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10004987 129 / 1e-35 AT3G46790 715 / 0.0 CHLORORESPIRATORY REDUCTION 2, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G119000 214 / 3e-66 AT5G44230 792 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.016G051300 137 / 4e-38 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.012G041200 136 / 1e-37 AT5G16860 1083 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G075800 136 / 2e-37 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G322100 134 / 9e-37 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G215500 132 / 5e-36 AT3G63370 922 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 86, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.004G059400 132 / 6e-36 AT4G18750 1110 / 0.0 DEFECTIVELY ORGANIZED TRIBUTARIES 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.003G031600 131 / 7e-36 AT3G15930 784 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G040100 130 / 2e-35 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G231200 129 / 2e-35 AT5G66520 504 / 1e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10025982 pacid=23173276 polypeptide=Lus10025982 locus=Lus10025982.g ID=Lus10025982.BGIv1.0 annot-version=v1.0
ATGTTAGTGTTGGAAATTGTCAAATTGGCTTATCACATTCATGCAAATCCAATTATAGCCGAAATTGCGGCAGCCCATCTGTTCGAGCTCGAACCGGACG
GTATTGGGAACTATATTCAGCTCTGCAGCACTTATGCAGCTGCTGAAAAATGGGACGATGTTTCTACGTTAAGGCGCATGATGAGAGGGAAAGGTCTCGA
CAAGAATCCTGGATATAGATGGATAGAAGCAGAAAAGGGCGTTATTCATAAGTTTGTTGCCCAGGACACGACCCATCCAAAGTCCAGGGAAATGAAGCAG
CTTCTTGAAGGTCTTCTAAACAAAATGGAGGCAAATGGGTACCAATGTAACCTGAGCACTATTCCGTACGGTGTGAGTGACGAGGAGAAGAGATCGGTTT
TGATGACTCGTAGCGAGAAATTGGCATTGGCCTTTGGGCTATTATGTTCCAAACCAGGCTCCACCATCAGGCTTATGAAGAACATCAGGATTTGCGACTG
CCATTTGTTCATGTGTGGAGCATCTTAA
AA sequence
>Lus10025982 pacid=23173276 polypeptide=Lus10025982 locus=Lus10025982.g ID=Lus10025982.BGIv1.0 annot-version=v1.0
MLVLEIVKLAYHIHANPIIAEIAAAHLFELEPDGIGNYIQLCSTYAAAEKWDDVSTLRRMMRGKGLDKNPGYRWIEAEKGVIHKFVAQDTTHPKSREMKQ
LLEGLLNKMEANGYQCNLSTIPYGVSDEEKRSVLMTRSEKLALAFGLLCSKPGSTIRLMKNIRICDCHLFMCGAS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G44230 Pentatricopeptide repeat (PPR)... Lus10025982 0 1
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10002613 4.5 0.7902
AT1G24020 MLP423 MLP-like protein 423 (.1.2) Lus10010699 6.2 0.7286
AT5G28540 BIP1 heat shock protein 70 (Hsp 70)... Lus10013056 12.5 0.7107
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10029390 13.6 0.7197
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10029913 15.7 0.7197
Lus10000400 17.6 0.7197
Lus10009372 19.3 0.7197
AT4G29280 LCR22 low-molecular-weight cysteine-... Lus10015983 20.8 0.7197
AT2G29110 ATGLR2.8 glutamate receptor 2.8 (.1) Lus10026877 22.3 0.7197
AT5G18460 Protein of Unknown Function (D... Lus10006860 23.6 0.7197

Lus10025982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.