Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G19630 179 / 4e-54 CYP722A1 "cytochrome P450, family 722, subfamily A, polypeptide 1", cytochrome P450, family 722, subfamily A, polypeptide 1 (.1) AT2G42850 114 / 1e-29 CYP718 "cytochrome P450, family 718", cytochrome P450, family 718 (.1) AT5G45340 111 / 8e-29 CYP707A3 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) AT4G19230 110 / 2e-28 CYP707A1 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) AT3G19270 109 / 4e-28 CYP707A4 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) AT2G29090 106 / 5e-27 CYP707A2 "cytochrome P450, family 707, subfamily A, polypeptide 2", cytochrome P450, family 707, subfamily A, polypeptide 2 (.1.2) AT4G36380 104 / 3e-26 ROT3 ROTUNDIFOLIA 3, Cytochrome P450 superfamily protein (.1) AT5G05690 102 / 4e-26 CBB3, DWF3, CYP90A1, CYP90A, CPD DWARF 3, CYTOCHROME P450 90A1, CONSTITUTIVE PHOTOMORPHOGENIC DWARF, CABBAGE 3, Cytochrome P450 superfamily protein (.1.2.3) AT1G12740 100 / 7e-25 CYP87A2 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2) AT5G38970 91 / 6e-22 ATBR6OX, CYP85A1, BR6OX1 brassinosteroid-6-oxidase 1 (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024272 [exp] 183 / 8e-56 AT1G19630 592 / 0.0 "cytochrome P450, family 722, subfamily A, polypeptide 1", cytochrome P450, family 722, subfamily A, polypeptide 1 (.1) Lus10028594 [exp] 147 / 5e-42 AT5G45340 299 / 1e-96 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10018898 [exp] 145 / 3e-41 AT5G45340 301 / 3e-97 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10021725 [exp] 109 / 3e-28 AT3G19270 633 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Lus10034768 [exp] 107 / 2e-27 AT5G45340 731 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10033308 [exp] 106 / 4e-27 AT5G45340 732 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Lus10035685 [exp] 105 / 1e-26 AT4G19230 714 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Lus10036670 [exp] 104 / 2e-26 AT1G05160 305 / 2e-98 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Lus10042652 [exp] 103 / 5e-26 AT3G19270 647 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G033000 [exp] 196 / 2e-60 AT1G19630 607 / 0.0 "cytochrome P450, family 722, subfamily A, polypeptide 1", cytochrome P450, family 722, subfamily A, polypeptide 1 (.1) Potri.002G069600 [exp] 147 / 4e-42 AT5G45340 296 / 1e-95 "cytochrome P450, family 707, subfamily A, polypeptide 3", cytochrome P450, family 707, subfamily A, polypeptide 3 (.1.2) Potri.004G235400 [exp] 111 / 6e-29 AT4G19230 778 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 1", cytochrome P450, family 707, subfamily A, polypeptide 1 (.1.2) Potri.014G029100 [exp] 110 / 1e-28 AT3G19270 665 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.018G134000 [exp] 105 / 1e-26 AT5G36110 559 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.012G115000 [exp] 104 / 3e-26 AT5G36110 295 / 7e-95 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.012G071300 [exp] 103 / 6e-26 AT1G05160 285 / 9e-91 ENT-KAURENOIC ACID OXYDASE 1, "cytochrome P450, family 88, subfamily A, polypeptide 3", cytochrome P450, family 88, subfamily A, polypeptide 3 (.1) Potri.018G133901 [exp] 103 / 8e-26 AT5G36110 526 / 0.0 "cytochrome P450, family 716, subfamily A, polypeptide 1", cytochrome P450, family 716, subfamily A, polypeptide 1 (.1) Potri.002G126100 [exp] 102 / 2e-25 AT3G19270 666 / 0.0 "cytochrome P450, family 707, subfamily A, polypeptide 4", cytochrome P450, family 707, subfamily A, polypeptide 4 (.1) Potri.009G064900 [exp] 100 / 7e-25 AT1G12740 477 / 5e-166 "cytochrome P450, family 87, subfamily A, polypeptide 2", cytochrome P450, family 87, subfamily A, polypeptide 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10025991 pacid=23173212 polypeptide=Lus10025991 locus=Lus10025991.g ID=Lus10025991.BGIv1.0 annot-version=v1.0 ATGATGTGGAGTGTCAAATTTCTGCACGACAATCAAGAAGCTCAGGATCGGCTCAGGGAAGAACAGTTGGCTATTGCCAGGGACAAAGCAGAGGACTATA TGCTTAGTCTAGCAGATGTCAACAGCATGTCCTACGGTCTGAAGGTCGTGAAAGAGACGCTAAGGATGTCGAATGTGTTGTTATGGTTCCCTAGAGTTGC TCTCAAGGACTGCACGAAGCAATCCTTTGATGGATTCGTTTCAGGAATCGAGATCAAGAAAGGATGGCACGCGAACATCGACGCTACATGCATCCATTAC GATCCTGAACTGTACAGCAATCCTCTGCAGTTCAACCCTTCCAGATTTGAAGAAATGCACAAGTCTTACAGTTTCATTCCGTTTGGCTCGGGGCCTCGGA CATGTTTAGGGATGAACATGGCCAAAGTAACACTCTTGGTTTTCCTCCACCGTTTAGCCGGCGGATACAAATGGACCGTTGACGATCTGGATCTCAGCCT GGAGAAGAAGTCCCATATTCCAAGACTCAGGAGCGGCTGTCCTATAACCTTGAAGGCCCTTTGA
AA sequence Show only first row Show all	>Lus10025991 pacid=23173212 polypeptide=Lus10025991 locus=Lus10025991.g ID=Lus10025991.BGIv1.0 annot-version=v1.0 MMWSVKFLHDNQEAQDRLREEQLAIARDKAEDYMLSLADVNSMSYGLKVVKETLRMSNVLLWFPRVALKDCTKQSFDGFVSGIEIKKGWHANIDATCIHY DPELYSNPLQFNPSRFEEMHKSYSFIPFGSGPRTCLGMNMAKVTLLVFLHRLAGGYKWTVDDLDLSLEKKSHIPRLRSGCPITLKAL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19630		CYP722A1	"cytochrome P450, family 722, ...		Lus10025991 [exp]	0	1
AT1G19630		CYP722A1	"cytochrome P450, family 722, ...		Lus10025990 [exp]	1.0	0.9835
AT1G14180			RING/U-box superfamily protein...		Lus10036764 [exp]	6.0	0.9522
					Lus10008233 [exp]	6.2	0.9411
					Lus10002693 [exp]	7.1	0.9436
AT3G26210		CYP71B23	"cytochrome P450, family 71, s...		Lus10018262 [exp]	7.4	0.9481
AT2G36780			UDP-Glycosyltransferase superf...		Lus10016268 [exp]	7.9	0.9262
AT1G16310			Cation efflux family protein (...		Lus10009598 [exp]	8.4	0.9474
AT2G39415			F-box family protein (.1)		Lus10042304 [exp]	10.2	0.9403
AT5G65980			Auxin efflux carrier family pr...		Lus10012708 [exp]	10.4	0.9443
AT5G06570			alpha/beta-Hydrolases superfam...		Lus10036168 [exp]	10.6	0.9402

Compare expression of checked genes

Lus10025991 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.