Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026002 pacid=23173170 polypeptide=Lus10026002 locus=Lus10026002.g ID=Lus10026002.BGIv1.0 annot-version=v1.0 ATGGCTCGGGATATAAAGGTCCCCGCTTCCAAGTACGTGGAAGAAAACCTCCTAAAACATAGCAAAGGGGGTTGTGACGATATACAAAGCTTCAGCGATG GGATAGCAGTGGCTGTGATGGCGTCCCAACTGGTTTGTGCTGACACTCAACTTGGTCAATAA
AA sequence Show only first row Show all	>Lus10026002 pacid=23173170 polypeptide=Lus10026002 locus=Lus10026002.g ID=Lus10026002.BGIv1.0 annot-version=v1.0 MARDIKVPASKYVEENLLKHSKGGCDDIQSFSDGIAVAVMASQLVCADTQLGQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10026002 [exp]	0	1
AT1G27180			disease resistance protein (TI...		Lus10000423 [exp]	8.8	0.7122
AT5G39590			TLD-domain containing nucleola...		Lus10012406 [exp]	32.7	0.6417
AT1G52980		AtNug2	nuclear/nucleolar GTPase 2, GT...		Lus10021016 [exp]	33.2	0.6295
AT5G21060			Glyceraldehyde-3-phosphate deh...		Lus10034077 [exp]	33.9	0.6394
					Lus10025864 [exp]	38.6	0.6066
AT5G10190			Major facilitator superfamily ...		Lus10027265 [exp]	55.9	0.6211
					Lus10030382 [exp]	61.3	0.6166
AT1G12920		ERF1-2	eukaryotic release factor 1-2 ...		Lus10026003 [exp]	88.9	0.5757
AT5G08400			Protein of unknown function (D...		Lus10008997 [exp]	114.6	0.5766
AT5G61890	AP2_ERF		Integrase-type DNA-binding sup...		Lus10006796 [exp]	126.2	0.5483

Compare expression of checked genes

Lus10026002 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.