Lus10026012 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45020 123 / 2e-35 Glutathione S-transferase family protein (.1.2)
AT4G19880 119 / 1e-33 Glutathione S-transferase family protein (.1.2.3)
AT5G44990 110 / 8e-31 Glutathione S-transferase family protein (.1.2.3)
AT5G44000 79 / 2e-18 Glutathione S-transferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027233 82 / 2e-19 AT5G44000 508 / 2e-180 Glutathione S-transferase family protein (.1)
Lus10005510 60 / 7e-12 AT4G19880 162 / 3e-48 Glutathione S-transferase family protein (.1.2.3)
Lus10014304 0 / 1 AT4G19880 499 / 3e-179 Glutathione S-transferase family protein (.1.2.3)
Lus10038348 0 / 1 AT4G19880 580 / 0.0 Glutathione S-transferase family protein (.1.2.3)
Lus10036209 0 / 1 AT4G19880 580 / 0.0 Glutathione S-transferase family protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G121600 124 / 2e-35 AT4G19880 600 / 0.0 Glutathione S-transferase family protein (.1.2.3)
Potri.014G192300 81 / 6e-19 AT5G44000 493 / 2e-174 Glutathione S-transferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0497 GST_C PF00043 GST_C Glutathione S-transferase, C-terminal domain
Representative CDS sequence
>Lus10026012 pacid=23173273 polypeptide=Lus10026012 locus=Lus10026012.g ID=Lus10026012.BGIv1.0 annot-version=v1.0
ATGGAGCCAGAAGCAGTAGGGACTTGTACGATCTCGCGAGCACAAATTACACCGGGAAGTATACAGTTCCAGTGCTGTGGGATAAAAAGCTCAGGATTCA
ACGACTTAGTAACATTGGACCTCTACCCTCCTCGATTACGAGACCGAATCGACGAAACTAATGGCAGGATAGATAGTGGGATAAACAGTGGTGTATACAA
ATGTGGGTTTGCCAGGAAGCAAAGTCCATACGAGGAGGCAATAAAAGAGTTGTATGAATCCTTCGACAATTGTGAGGCGATACTCAATAAGCAACGATAT
ATTTGTGGAGACGTATTGACTGAAGCAGACATCCGTCTGTTTGTTACATGA
AA sequence
>Lus10026012 pacid=23173273 polypeptide=Lus10026012 locus=Lus10026012.g ID=Lus10026012.BGIv1.0 annot-version=v1.0
MEPEAVGTCTISRAQITPGSIQFQCCGIKSSGFNDLVTLDLYPPRLRDRIDETNGRIDSGINSGVYKCGFARKQSPYEEAIKELYESFDNCEAILNKQRY
ICGDVLTEADIRLFVT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45020 Glutathione S-transferase fami... Lus10026012 0 1
AT3G61510 AT-ACS1, ACS1 ARABIDOPSIS THALIANA 1-AMINOCY... Lus10007910 1.0 0.9807
AT2G37770 ChlAKR, AKR4C9 Chloroplastic aldo-keto reduct... Lus10024354 4.0 0.9490
AT5G44390 FAD-binding Berberine family p... Lus10038442 4.0 0.9668
AT2G44450 BGLU15 beta glucosidase 15 (.1) Lus10031235 5.9 0.9590
AT5G12340 unknown protein Lus10036031 6.0 0.9591
Lus10010270 6.9 0.9576
AT4G11410 NAD(P)-binding Rossmann-fold s... Lus10035479 8.1 0.9609
AT2G23770 protein kinase family protein ... Lus10018788 8.2 0.9625
AT1G03940 HXXXD-type acyl-transferase fa... Lus10039745 10.2 0.9542
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10041831 10.2 0.9361

Lus10026012 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.