Lus10026015 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18400 179 / 3e-59 ribosomal protein L6 family protein (.1)
AT1G05190 87 / 1e-21 EMB2394 embryo defective 2394, Ribosomal protein L6 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014306 193 / 2e-64 AT2G18400 179 / 4e-60 ribosomal protein L6 family protein (.1)
Lus10029120 77 / 2e-17 AT1G05190 312 / 5e-109 embryo defective 2394, Ribosomal protein L6 family (.1)
Lus10013041 77 / 3e-17 AT1G05190 310 / 3e-107 embryo defective 2394, Ribosomal protein L6 family (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G024900 190 / 3e-63 AT2G18400 173 / 6e-58 ribosomal protein L6 family protein (.1)
Potri.014G153000 83 / 8e-20 AT1G05190 338 / 3e-119 embryo defective 2394, Ribosomal protein L6 family (.1)
Potri.002G229350 71 / 2e-16 AT1G05190 138 / 3e-42 embryo defective 2394, Ribosomal protein L6 family (.1)
Potri.002G229325 71 / 2e-15 AT1G05190 272 / 2e-93 embryo defective 2394, Ribosomal protein L6 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00347 Ribosomal_L6 Ribosomal protein L6
Representative CDS sequence
>Lus10026015 pacid=23173165 polypeptide=Lus10026015 locus=Lus10026015.g ID=Lus10026015.BGIv1.0 annot-version=v1.0
ATGAATGATTACCCTAGCCTGCCGAGTTGGACTAAGAGCTTGGCTGGGATTTCATTTTCTGGAAACGAAGGATCGAGCAACAAGGAAGAAGAGGGGTTGG
AGCAGAGGAACAAGGCACAGCAATCCAGGAATTTGATTTCGGATACTCCATTTCGAATCAAAGAGCTTCCTGGTTTCACTCTCAATCATTCAACAATGGA
GGCCAAATTCTTCCGATTTCTGAAGATTGTTGGTGTTGGGTATAAAGCAAGAGCTGAAGCAGAAGGCCGCTTGTTATTTCTGAAATTGGGTTACAGTCAT
GAAGTGGAGCTGACAGTTCCCCCAGCTGTTAGGGTTTTCTGCTTCAAGAACAATGTGGTTTGCTGCACTGGGATCGACAAGCAAAGGGTGCACCAATTTG
CTGCTACTGTTCGCAGTTGCAAGCCTCCAGAAGTTTATAAAGGCAAAGGCATCATGTACATCGATGAAGTGATCAAGAAGAAACAGGGCAAGAAATCCAA
GTGA
AA sequence
>Lus10026015 pacid=23173165 polypeptide=Lus10026015 locus=Lus10026015.g ID=Lus10026015.BGIv1.0 annot-version=v1.0
MNDYPSLPSWTKSLAGISFSGNEGSSNKEEEGLEQRNKAQQSRNLISDTPFRIKELPGFTLNHSTMEAKFFRFLKIVGVGYKARAEAEGRLLFLKLGYSH
EVELTVPPAVRVFCFKNNVVCCTGIDKQRVHQFAATVRSCKPPEVYKGKGIMYIDEVIKKKQGKKSK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G18400 ribosomal protein L6 family pr... Lus10026015 0 1
AT4G30220 RUXF small nuclear ribonucleoprotei... Lus10006867 1.0 0.8953
AT2G18400 ribosomal protein L6 family pr... Lus10014306 2.4 0.8670
AT3G23390 Zinc-binding ribosomal protein... Lus10013436 4.2 0.8899
AT2G19740 Ribosomal protein L31e family ... Lus10042028 5.2 0.8874
AT2G20450 Ribosomal protein L14 (.1) Lus10024918 5.5 0.8845
AT1G77940 Ribosomal protein L7Ae/L30e/S1... Lus10027926 5.9 0.8627
AT3G23390 Zinc-binding ribosomal protein... Lus10040983 6.6 0.8848
AT1G47278 unknown protein Lus10040837 7.5 0.7659
AT1G47278 unknown protein Lus10016567 7.6 0.8030
AT5G09270 unknown protein Lus10004877 10.1 0.8235

Lus10026015 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.