Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G21170 37 / 0.0008 F-box and associated interaction domains-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014320 [exp] 155 / 1e-47 AT5G07610 74 / 2e-14 F-box family protein (.1) Lus10041733 [exp] 61 / 3e-12 AT5G07610 79 / 1e-15 F-box family protein (.1) Lus10024021 [exp] 54 / 1e-09 AT5G07610 79 / 9e-16 F-box family protein (.1) Lus10015048 [exp] 43 / 1e-05 AT5G07610 74 / 3e-14 F-box family protein (.1) Lus10042989 [exp] 39 / 0.0001 AT5G07610 82 / 9e-19 F-box family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G027300 [exp] 113 / 2e-31 AT5G49610 80 / 2e-16 F-box family protein (.1) Potri.005G124500 [exp] 65 / 1e-13 AT5G03970 77 / 3e-15 F-box associated ubiquitination effector family protein (.1.2) Potri.007G027200 [exp] 58 / 3e-11 AT5G07610 84 / 1e-17 F-box family protein (.1) Potri.015G028500 [exp] 55 / 4e-10 AT5G49610 78 / 1e-15 F-box family protein (.1) Potri.010G254000 [exp] 38 / 0.0003 AT5G07610 149 / 1e-40 F-box family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026028 pacid=23173093 polypeptide=Lus10026028 locus=Lus10026028.g ID=Lus10026028.BGIv1.0 annot-version=v1.0 ATGGCCTTTGAGCCTTCGCGACTCAACTTCGTCGCAGAGTACAAGCTCGTCTGTGCATTTCCATCTGATCTGGACGGGTATGAATTCGAGATATATTCTT CTGCTGATGAAACTTGGAGAATCTCCGGAGAGATTTGCTTCGGAGACAGGAAGCTGGTATCCACTTCAGGCATCTTCGCCGGTGGTATCGCTTACTGGCA GTCGAAGAGTTGGGGTATTTTAGCCTTTGATCTCACAAGCGAGCGCTCTACTCTTCAGTACTCCCCGGGGGAATGTTATCGGTTGTGTGAATGA
AA sequence Show only first row Show all	>Lus10026028 pacid=23173093 polypeptide=Lus10026028 locus=Lus10026028.g ID=Lus10026028.BGIv1.0 annot-version=v1.0 MAFEPSRLNFVAEYKLVCAFPSDLDGYEFEIYSSADETWRISGEICFGDRKLVSTSGIFAGGIAYWQSKSWGILAFDLTSERSTLQYSPGECYRLCE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10026028 [exp]	0	1
AT3G51770		ATEOL1, ETO1	ARABIDOPSIS ETHYLENE OVERPRODU...		Lus10012472 [exp]	3.3	0.7890
AT5G04050			RNA-directed DNA polymerase (r...		Lus10036278 [exp]	7.6	0.7839
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Lus10042439 [exp]	7.7	0.7726
AT4G24470	GATA	GATA25, TIFY1, ...	Zinc-finger protein expressed ...		Lus10042865 [exp]	14.0	0.7721
AT3G60910			S-adenosyl-L-methionine-depend...		Lus10019750 [exp]	17.7	0.6719
AT5G15270			RNA-binding KH domain-containi...		Lus10033556 [exp]	17.9	0.7610
					Lus10042563 [exp]	19.4	0.7566
AT4G37460		SRFR1	SUPPRESSOR OF RPS4-RLD 1, Tetr...		Lus10014863 [exp]	22.4	0.7474
AT2G45880	BZR	BAM7, BMY4	BETA-AMYLASE 4, beta-amylase 7...		Lus10017819 [exp]	23.6	0.7280
AT2G25660		EMB2410	embryo defective 2410 (.1)		Lus10022111 [exp]	26.7	0.7404

Compare expression of checked genes

Lus10026028 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.