Lus10026038 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G36800 341 / 1e-121 RCE1 RUB1 conjugating enzyme 1 (.1.2)
AT2G18600 321 / 9e-114 Ubiquitin-conjugating enzyme family protein (.1)
AT5G56150 101 / 9e-28 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT5G53300 101 / 1e-27 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
AT5G41700 100 / 2e-27 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT3G08690 100 / 3e-27 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT2G16740 100 / 6e-27 UBC29 ubiquitin-conjugating enzyme 29 (.1)
AT4G27960 99 / 1e-26 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT1G64230 98 / 2e-26 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT3G08700 92 / 4e-24 UBC12 ubiquitin-conjugating enzyme 12 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014329 374 / 6e-134 AT4G36800 332 / 3e-117 RUB1 conjugating enzyme 1 (.1.2)
Lus10010143 265 / 8e-92 AT4G36800 257 / 1e-88 RUB1 conjugating enzyme 1 (.1.2)
Lus10028700 105 / 4e-29 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10009422 105 / 4e-29 AT3G08690 285 / 2e-100 ubiquitin-conjugating enzyme 11 (.1.2)
Lus10027846 100 / 6e-27 AT1G64230 289 / 3e-102 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10027570 97 / 6e-26 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10039323 97 / 6e-26 AT1G64230 303 / 8e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10032352 97 / 7e-26 AT5G53300 302 / 2e-107 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Lus10022726 97 / 1e-25 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G030900 362 / 5e-130 AT4G36800 340 / 2e-121 RUB1 conjugating enzyme 1 (.1.2)
Potri.005G126500 346 / 1e-123 AT4G36800 332 / 3e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.T125904 338 / 1e-120 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.009G113045 338 / 1e-120 AT4G36800 332 / 5e-118 RUB1 conjugating enzyme 1 (.1.2)
Potri.014G041532 139 / 1e-42 AT4G36800 137 / 5e-42 RUB1 conjugating enzyme 1 (.1.2)
Potri.014G041466 112 / 1e-32 AT2G18600 104 / 3e-30 Ubiquitin-conjugating enzyme family protein (.1)
Potri.004G175000 100 / 2e-27 AT5G53300 292 / 2e-103 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Potri.001G094900 99 / 2e-26 AT1G64230 302 / 2e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.003G136200 99 / 2e-26 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 99 / 2e-26 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10026038 pacid=23173272 polypeptide=Lus10026038 locus=Lus10026038.g ID=Lus10026038.BGIv1.0 annot-version=v1.0
ATGATTCGTTTGTTTAAAGTTAAGGAACAGCAGAGGGAACAAGCTGAGAATGCCAACGGAGGAATGCCAGTTAAAAAGCAAAGTGCTGGAGAGCTTCGGC
TTCACAAGGATATCTCCGAGCTGAACCTTCCCAAGTCATGTGCCATTACGTTCCCCAATGGCAAAGACGACCTGATGAACTTTGAGGTCTCGATTCGACC
AGATGAAGGGTATTATGCAGGTGGAACGTTTTTATTCACTTTCCAAGTCTCTCCTATCTATCCGCACGAGGCACCGAAAGTTAAATGCAAGACAAAGGTG
TACCATCCAAACATCGACTTAGAGGGGAATGTTTGTCTTAACATATTGCGAGAAGACTGGAAGCCAGTTCTTAACATCAATACTATTATCTACGGACTAT
ATCATCTGTTTACGGAGCCGAACTACGAGGATCCTCTGAATCACGAAGCGGCTGCTGTGTTGAGGGATCACCCAAAGATGTTCGAATCAAACGTGAGGAG
GGCGATGACAGGAGGCTATGTCGGGCAGACTTATTTTACGCGTTGTATCTAG
AA sequence
>Lus10026038 pacid=23173272 polypeptide=Lus10026038 locus=Lus10026038.g ID=Lus10026038.BGIv1.0 annot-version=v1.0
MIRLFKVKEQQREQAENANGGMPVKKQSAGELRLHKDISELNLPKSCAITFPNGKDDLMNFEVSIRPDEGYYAGGTFLFTFQVSPIYPHEAPKVKCKTKV
YHPNIDLEGNVCLNILREDWKPVLNINTIIYGLYHLFTEPNYEDPLNHEAAAVLRDHPKMFESNVRRAMTGGYVGQTYFTRCI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G36800 RCE1 RUB1 conjugating enzyme 1 (.1.... Lus10026038 0 1
AT2G16530 3-oxo-5-alpha-steroid 4-dehydr... Lus10042055 2.4 0.9182
AT5G53530 VPS26A vacuolar protein sorting 26A (... Lus10008868 2.8 0.9200
AT3G13200 EMB2769 EMBRYO DEFECTIVE 2769, Cwf15 /... Lus10016651 3.5 0.9330
AT2G32260 ATCCT1 phosphorylcholine cytidylyltra... Lus10003808 5.7 0.9132
AT1G59600 ZCW7 ZCW7 (.1) Lus10018676 5.9 0.9082
AT2G38900 Serine protease inhibitor, pot... Lus10035626 7.1 0.9037
AT2G27285 Coiled-coil domain-containing ... Lus10038787 7.2 0.8732
AT3G21865 PEX22 peroxin 22 (.1) Lus10039690 8.9 0.9069
AT5G13180 NAC VNDIP2, ANAC083... VND-interacting 2, NAC domain ... Lus10001809 9.5 0.9113
AT5G47840 AMK2 adenosine monophosphate kinase... Lus10009477 10.1 0.8735

Lus10026038 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.