Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G10130 159 / 3e-50 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G08685 139 / 2e-42 SAH7 Pollen Ole e 1 allergen and extensin family protein (.1) AT1G78040 119 / 1e-34 Pollen Ole e 1 allergen and extensin family protein (.1.2) AT1G29140 92 / 7e-24 Pollen Ole e 1 allergen and extensin family protein (.1) AT4G18596 89 / 8e-23 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G45880 87 / 4e-22 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G15780 42 / 8e-05 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G41050 41 / 0.0001 Pollen Ole e 1 allergen and extensin family protein (.1) AT3G09925 40 / 0.0002 Pollen Ole e 1 allergen and extensin family protein (.1) AT5G47635 40 / 0.0002 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014332 [exp] 313 / 3e-111 AT5G10130 154 / 2e-48 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10041707 [exp] 237 / 3e-81 AT5G10130 150 / 9e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042201 [exp] 139 / 1e-42 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10008615 [exp] 138 / 5e-42 AT4G08685 166 / 3e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10001895 [exp] 101 / 2e-27 AT1G29140 157 / 2e-49 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013908 [exp] 97 / 4e-24 AT2G42590 400 / 1e-139 general regulatory factor 9 (.1.2.3) Lus10028134 [exp] 92 / 4e-24 AT1G29140 118 / 4e-34 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10042838 [exp] 89 / 8e-23 AT1G29140 115 / 6e-33 Pollen Ole e 1 allergen and extensin family protein (.1) Lus10013681 [exp] 86 / 2e-21 AT1G29140 117 / 6e-34 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G078200 [exp] 186 / 2e-61 AT4G08685 165 / 5e-53 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.007G090100 [exp] 184 / 3e-60 AT4G08685 152 / 1e-47 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.005G167900 [exp] 145 / 6e-45 AT4G08685 171 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.002G093100 [exp] 144 / 2e-44 AT4G08685 199 / 3e-66 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.011G111300 [exp] 108 / 1e-30 AT1G29140 148 / 4e-46 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G392400 [exp] 98 / 3e-26 AT1G29140 137 / 1e-41 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.004G114300 [exp] 53 / 1e-08 AT5G15780 178 / 5e-52 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.003G167100 [exp] 52 / 4e-08 AT5G13140 180 / 2e-55 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.001G326200 [exp] 50 / 4e-08 AT5G41050 158 / 9e-50 Pollen Ole e 1 allergen and extensin family protein (.1) Potri.017G068400 [exp] 49 / 2e-07 AT5G41050 172 / 3e-55 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0287 [flax] [poplar] Transthyretin PF01190 [flax] [poplar] Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence Show only first row Show all	>Lus10026040 pacid=23173197 polypeptide=Lus10026040 locus=Lus10026040.g ID=Lus10026040.BGIv1.0 annot-version=v1.0 ATGGCGTCCATAGCTCGATGCTCGTTGCTTATTCTAGCCGTCCTCTGTGTCGTCCTCCCCGTATTAACCACATCCAAGTTCGCGCCCTTCGTCATTCGGG GCAGCGTCTACTGTGATACTTGCCGCTGCGGCTTTGAGACCAACAAAACCACTTACATTCCAGGGGCGACGGTAGCGATCAAGTGCAAGGACAGGCAAAC ACTACAGAAGAAGTACAGCAACGATGCGACGACGGATAAGAACGGCATGTACCAGATCACCGTCAAGGGTGATCACGGCGACCAGATTTGCGAGTCTGTC CTCGTCAGCAGCCCTGTAGCAAACTGCAAGGTTGCGGATCCGGGTCGATCCTATTCGGAAGTCATCTTGACCCGGTCCAACGGCGCCATCTCCAACCTGC ATTTCGCGAACGCTATGGGTTTCCTCAAGGACGAAGCAGAGGAGGGTTGTACTGAGCTCGTCCACGAACTGCTCTTCTCCGATCTTTGA
AA sequence Show only first row Show all	>Lus10026040 pacid=23173197 polypeptide=Lus10026040 locus=Lus10026040.g ID=Lus10026040.BGIv1.0 annot-version=v1.0 MASIARCSLLILAVLCVVLPVLTTSKFAPFVIRGSVYCDTCRCGFETNKTTYIPGATVAIKCKDRQTLQKKYSNDATTDKNGMYQITVKGDHGDQICESV LVSSPVANCKVADPGRSYSEVILTRSNGAISNLHFANAMGFLKDEAEEGCTELVHELLFSDL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G10130			Pollen Ole e 1 allergen and ex...		Lus10026040 [exp]	0	1
AT5G14920			Gibberellin-regulated family p...		Lus10032168 [exp]	1.4	0.9729
AT3G24750			unknown protein		Lus10025939 [exp]	3.5	0.9665
AT5G24070			Peroxidase superfamily protein...		Lus10004804 [exp]	3.5	0.9407
AT3G24750			unknown protein		Lus10038162 [exp]	6.7	0.9658
AT2G17080			Arabidopsis protein of unknown...		Lus10025126 [exp]	7.2	0.9524
AT2G17080			Arabidopsis protein of unknown...		Lus10014450 [exp]	7.7	0.9494
AT2G17080			Arabidopsis protein of unknown...		Lus10023965 [exp]	7.7	0.9513
AT1G50060			CAP (Cysteine-rich secretory p...		Lus10025697 [exp]	8.3	0.9224
AT3G19200			unknown protein		Lus10019867 [exp]	8.4	0.9430
AT2G17080			Arabidopsis protein of unknown...		Lus10025120 [exp]	8.8	0.9425

Compare expression of checked genes

Lus10026040 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.