Lus10026042 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026042 pacid=23173105 polypeptide=Lus10026042 locus=Lus10026042.g ID=Lus10026042.BGIv1.0 annot-version=v1.0
ATGTCGGGGCTGGTCGTAGCAGCGATGCCTATATGTCATCTATTAGTTGTTATCTTTGCTGTTTCCTATCGGGGAAGGACATGGGATCATGCCTATATGG
TCGACTCGGCGTTAGTAGACGGTGTCTTGAAGTTGGCTGCATGTTTTCTCTGTGTGCAAGTCGTCGTTGTTCTACTTATTACCTTGACTCTGGCATGGGT
TGATACTCCGGACGTGCACATTACATCTGCCCAGAAATATGGATCTTCTGCTGTGGTGGCATTTCTAGCCATCGCAAGGTCGATGCTAGACAAACATGTC
CCTACTGAGGATCAAAGATCGAAAGGGACCTCGTCCCTTTTTAAGTGCGAAAGAAAAGGAACGGGAGTACTGGATCGAGTTTGA
AA sequence
>Lus10026042 pacid=23173105 polypeptide=Lus10026042 locus=Lus10026042.g ID=Lus10026042.BGIv1.0 annot-version=v1.0
MSGLVVAAMPICHLLVVIFAVSYRGRTWDHAYMVDSALVDGVLKLAACFLCVQVVVVLLITLTLAWVDTPDVHITSAQKYGSSAVVAFLAIARSMLDKHV
PTEDQRSKGTSSLFKCERKGTGVLDRV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026042 0 1
AT2G36190 ATCWINV4 cell wall invertase 4 (.1) Lus10014217 2.4 1.0000
AT3G16857 GARP ARR1 response regulator 1 (.1.2) Lus10039345 4.0 1.0000
AT5G14760 AO L-aspartate oxidase (.1) Lus10018901 4.2 1.0000
Lus10024762 4.5 1.0000
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027891 5.1 1.0000
Lus10013658 5.1 1.0000
AT3G25810 Terpenoid cyclases/Protein pre... Lus10010970 5.7 1.0000
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10027513 7.7 1.0000
AT5G05340 Peroxidase superfamily protein... Lus10009090 8.5 1.0000
Lus10020402 8.7 1.0000

Lus10026042 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.