Lus10026059 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10014350 127 / 1e-37 AT1G80730 110 / 1e-29 ARABIDOPSIS THALIANA ZINC-FINGER PROTEIN 1, zinc-finger protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G047500 52 / 1e-08 AT5G10970 143 / 5e-41 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.003G180600 51 / 2e-08 AT5G10970 144 / 1e-41 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.018G021400 46 / 1e-06 AT5G10970 165 / 8e-50 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.006G261700 43 / 1e-05 AT5G10970 166 / 4e-50 C2H2 and C2HC zinc fingers superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10026059 pacid=23173265 polypeptide=Lus10026059 locus=Lus10026059.g ID=Lus10026059.BGIv1.0 annot-version=v1.0
ATGAGGGCTTCTTCGTCTTTTCACTTCTCCTCCAGCATTTCCGCCCTTCCCTTGCACGGTTCGCCGCTCGGAATTCAGGCCCATTCGCTGATCCACAAGC
CCAATATTATTAGTATCGCCGACCAGCGACGTCCCGCCGTCGGCCGGCTGGCGGCGGAGTATAATTTCCACCTAGGATCCTCGACGACGACGTCGTCTGG
CAGGTTTGATGCTGGCCGGAGGGTATCTCCTGCGACGGCGGATGGGATTATGATGATGCACCACGGCGGTGGTGGTGGGTTTTGGTGGAGTGGTGGCGGG
GGTGGGGACGGCGGTGGTGTTCGCCCTAAACAAGATGATTTGCCAAAGCTTGATCTCTCACTTAAGCTGTGA
AA sequence
>Lus10026059 pacid=23173265 polypeptide=Lus10026059 locus=Lus10026059.g ID=Lus10026059.BGIv1.0 annot-version=v1.0
MRASSSFHFSSSISALPLHGSPLGIQAHSLIHKPNIISIADQRRPAVGRLAAEYNFHLGSSTTTSSGRFDAGRRVSPATADGIMMMHHGGGGGFWWSGGG
GGDGGGVRPKQDDLPKLDLSLKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026059 0 1
AT1G66340 AtETR1, EIN1, E... ETHYLENE RESPONSE 1, ETHYLENE ... Lus10031382 17.7 0.8607
AT2G01490 phytanoyl-CoA dioxygenase (Phy... Lus10013462 22.9 0.8627
AT5G10830 S-adenosyl-L-methionine-depend... Lus10002994 31.1 0.8423
AT2G25735 unknown protein Lus10007679 36.3 0.8187
AT1G70570 anthranilate phosphoribosyltra... Lus10006201 39.8 0.8452
AT3G46540 ENTH/VHS family protein (.1) Lus10016556 43.3 0.8415
AT1G54610 Protein kinase superfamily pro... Lus10004144 46.1 0.8301
AT3G25570 Adenosylmethionine decarboxyla... Lus10031919 55.0 0.8338
AT4G03420 Protein of unknown function (D... Lus10018572 75.6 0.8249
AT3G62270 HCO3- transporter family (.1) Lus10009995 79.5 0.8082

Lus10026059 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.