Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G80920 130 / 3e-39 AtToc12, AtJ8, J8 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) AT1G72070 59 / 1e-11 Chaperone DnaJ-domain superfamily protein (.1) AT5G59610 54 / 4e-09 Chaperone DnaJ-domain superfamily protein (.1.2) AT3G08970 54 / 6e-09 TMS1, ATERDJ3A THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) AT1G79940 51 / 5e-08 ATERDJ2A DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) AT5G16650 49 / 5e-08 Chaperone DnaJ-domain superfamily protein (.1) AT4G21180 50 / 1e-07 ATERDJ2B DnaJ / Sec63 Brl domains-containing protein (.1) AT3G62600 49 / 2e-07 ATERDJ3B DNAJ heat shock family protein (.1) AT2G33735 47 / 3e-07 Chaperone DnaJ-domain superfamily protein (.1) AT1G80030 47 / 1e-06 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014352 [exp] 241 / 3e-83 AT1G80920 135 / 2e-41 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10024067 [exp] 159 / 1e-50 AT1G80920 130 / 4e-39 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10041671 [exp] 144 / 1e-44 AT1G80920 138 / 2e-42 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Lus10003380 [exp] 63 / 5e-12 AT3G08970 615 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10002852 [exp] 62 / 1e-11 AT3G08970 600 / 0.0 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Lus10040777 [exp] 59 / 9e-11 AT5G59610 246 / 6e-81 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10016510 [exp] 59 / 9e-11 AT5G59610 252 / 2e-83 Chaperone DnaJ-domain superfamily protein (.1.2) Lus10039293 [exp] 55 / 3e-09 AT1G79940 1086 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Lus10027536 [exp] 55 / 3e-09 AT1G79940 1087 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G183700 [exp] 155 / 8e-49 AT1G80920 130 / 4e-39 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Potri.001G043100 [exp] 154 / 1e-48 AT1G80920 129 / 2e-38 translocon at the outer envelope membrane of chloroplasts 12, Chaperone DnaJ-domain superfamily protein (.1) Potri.016G120000 [exp] 61 / 1e-11 AT3G08970 479 / 6e-164 THERMOSENSITIVE MALE STERILE 1, DNAJ heat shock N-terminal domain-containing protein (.1) Potri.001G072700 [exp] 55 / 2e-09 AT5G59610 254 / 3e-84 Chaperone DnaJ-domain superfamily protein (.1.2) Potri.014G122600 [exp] 52 / 2e-08 AT3G62600 565 / 0.0 DNAJ heat shock family protein (.1) Potri.019G041400 [exp] 49 / 5e-08 AT5G16650 193 / 5e-65 Chaperone DnaJ-domain superfamily protein (.1) Potri.004G072200 [exp] 50 / 1e-07 AT1G79940 1087 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Potri.017G148800 [exp] 50 / 2e-07 AT1G79940 1062 / 0.0 DnaJ / Sec63 Brl domains-containing protein (.1.2.3.4) Potri.001G469600 [exp] 47 / 3e-07 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G198000 [exp] 48 / 4e-07 AT3G62600 551 / 0.0 DNAJ heat shock family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10026061 pacid=23173221 polypeptide=Lus10026061 locus=Lus10026061.g ID=Lus10026061.BGIv1.0 annot-version=v1.0 ATGGCCACCACTGCTTTCGCCGCTAATGGAATGATCGGAGGAAGCCGATGCGGCGGATCTTCGAACGGCCGGAAGAACAATGTCGCCGGTAGAAGAATCT CGTCGCCGATGTTCTGCGTAGCTTCTTCGTCTTCGGTGATGGATCCTTACAAGACGCTGAGGATCCAGCCCGGCGCTTCTGAATCGGAGGTCCGGAAAGC CTTCCGCAAGCTCGCTCTCCAGTATCATCCAGATGTTTGCAAAGGGAAAAACTGTGGAGTCCAGTTCAGCCAAATCAATGCAGCCTACGGCGCTGTGATG AGCAGATTGAGAGAGGAACCGTCGGTGGAGGAGGAGATGGTGGAAGAAGTCGCGGAGGAGCCGATGTACGCTCCGGATTATGAATTGTGGGAGGAGTGGA TGGGATGGGAAGGAGCAGGAATCAGGGATTACACTTCTCATATCAATCCTTACATCTGA
AA sequence Show only first row Show all	>Lus10026061 pacid=23173221 polypeptide=Lus10026061 locus=Lus10026061.g ID=Lus10026061.BGIv1.0 annot-version=v1.0 MATTAFAANGMIGGSRCGGSSNGRKNNVAGRRISSPMFCVASSSSVMDPYKTLRIQPGASESEVRKAFRKLALQYHPDVCKGKNCGVQFSQINAAYGAVM SRLREEPSVEEEMVEEVAEEPMYAPDYELWEEWMGWEGAGIRDYTSHINPYI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G80920		AtToc12, AtJ8, ...	translocon at the outer envelo...		Lus10026061 [exp]	0	1
AT5G67480		ATBT4, BT4	BTB and TAZ domain protein 4 (...		Lus10011523 [exp]	1.0	0.9108
AT4G05000		VPS28-2, VPS28-...	vacuolar protein sorting-assoc...		Lus10027228 [exp]	2.8	0.8263
AT3G63130		ATRANGAP1, RANG...	RAN GTPASE-ACTIVATING PROTEIN ...		Lus10006930 [exp]	8.0	0.7597
AT1G15670			Galactose oxidase/kelch repeat...		Lus10029329 [exp]	8.4	0.7093
AT4G03140			NAD(P)-binding Rossmann-fold s...		Lus10005927 [exp]	8.5	0.7957
AT3G22250			UDP-Glycosyltransferase superf...		Lus10031068 [exp]	8.7	0.7440
AT2G27310			F-box family protein (.1)		Lus10028024 [exp]	10.4	0.8184
AT4G36850			PQ-loop repeat family protein ...		Lus10022491 [exp]	10.9	0.7585
AT4G30780			unknown protein		Lus10035819 [exp]	14.0	0.7987
AT3G06500		A/N-InvC	alkaline/neutral invertase C, ...		Lus10037817 [exp]	15.9	0.7865

Compare expression of checked genes

Lus10026061 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.