Lus10026075 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002304 114 / 2e-32 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10026075 pacid=23173108 polypeptide=Lus10026075 locus=Lus10026075.g ID=Lus10026075.BGIv1.0 annot-version=v1.0
ATGTTCATCGGCATGTTTCTCGCCGTGGCCGGACAGTTTGGTGGTCGTGTCCCGGCGGCAAGACTTGATTTCGTATCGCCGCCGTGCACCAAGAATTCGA
TATCCAGCCCTGATGTGGCGGTAAGCGTGGCAAAAGTGGTAGATTATGTGGTGCAGTACACGTCCACCGTAGCCAGCTATACGTTACGCCACCAAGTGAA
GACCGGCGACGCTACCTGCTACGGCTACGCTTATTTGTACGATTTTAGAGAGAAAAATGAATTAGAGAGAATTGGAATCGTTGAATTATTCGAGGAGAGG
AGTTCAGTATATATAATCATCAGCATCCATTCTCAGCTCTACTACAGTATTACCGAAAAGCAGAAATACACAGAAGTAAAAACACGTGTCACAGCACGGT
ACGCAGCGGTAAAACAACAGAGCGGGCTCCTATCTGAATTGCAAATGCAGCGCCTTAATGATAACCAAGCTCAAGTCTACACCGACTATTGTTACTTGAC
GTATGGTCCTACTCCGGTTTAA
AA sequence
>Lus10026075 pacid=23173108 polypeptide=Lus10026075 locus=Lus10026075.g ID=Lus10026075.BGIv1.0 annot-version=v1.0
MFIGMFLAVAGQFGGRVPAARLDFVSPPCTKNSISSPDVAVSVAKVVDYVVQYTSTVASYTLRHQVKTGDATCYGYAYLYDFREKNELERIGIVELFEER
SSVYIIISIHSQLYYSITEKQKYTEVKTRVTARYAAVKQQSGLLSELQMQRLNDNQAQVYTDYCYLTYGPTPV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10026075 0 1
AT2G14100 CYP705A13 "cytochrome P450, family 705, ... Lus10024582 4.5 0.8880
AT5G52390 PAR1 protein (.1) Lus10016450 5.3 0.9069
AT2G37240 Thioredoxin superfamily protei... Lus10019900 5.5 0.8659
AT2G40610 ATHEXPALPHA1.11... expansin A8 (.1) Lus10009917 6.6 0.8653
AT5G01660 unknown protein Lus10002863 11.2 0.8169
AT4G16740 ATTPS03 terpene synthase 03 (.1.2) Lus10039713 14.8 0.8648
AT5G41020 MYB myb family transcription facto... Lus10022932 17.9 0.8558
AT2G37460 nodulin MtN21 /EamA-like trans... Lus10024425 19.1 0.7931
AT5G10520 RBK1 ROP binding protein kinases 1 ... Lus10002659 19.6 0.8520
AT3G05610 Plant invertase/pectin methyle... Lus10020909 21.0 0.8393

Lus10026075 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.