Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026081 pacid=23173289 polypeptide=Lus10026081 locus=Lus10026081.g ID=Lus10026081.BGIv1.0 annot-version=v1.0 ATGGCGAGCTGCTTCAGAAGTGATCAGCTCTGTCTTCTGGTAATTTATGCAACGCTTGTAATCTGCCTCGTTATCTTCCCATCCATGGCGGCGCCTGCCA GAATTGGTTCTGTTCCCAGCTCTGAAGGGCATGAGAAGAGAGGTTTCTGGGGATTATTTGCGGTGAGTAAGATTAGCGCAGGGGGGCATCCTTCGAATCC TGACAATCACGGACATCATTGA
AA sequence Show only first row Show all	>Lus10026081 pacid=23173289 polypeptide=Lus10026081 locus=Lus10026081.g ID=Lus10026081.BGIv1.0 annot-version=v1.0 MASCFRSDQLCLLVIYATLVICLVIFPSMAAPARIGSVPSSEGHEKRGFWGLFAVSKISAGGHPSNPDNHGHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10026081 [exp]	0	1
AT3G29635			HXXXD-type acyl-transferase fa...		Lus10005362 [exp]	2.0	0.9713
AT5G60600		HDS, ISPG, CSB3...	CONSTITUTIVE SUBTILISIN 3, CHL...		Lus10022583 [exp]	3.5	0.9669
AT5G60600		HDS, ISPG, CSB3...	CONSTITUTIVE SUBTILISIN 3, CHL...		Lus10021480 [exp]	4.2	0.9658
AT2G26930		CMK, CMEK, ISPE...	PIGMENT DEFECTIVE 277, 4-\(cyt...		Lus10036098 [exp]	5.9	0.9619
AT2G29420		GST25, ATGSTU7	GLUTATHIONE S-TRANSFERASE 25, ...		Lus10016470 [exp]	6.7	0.9509
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10001210 [exp]	6.9	0.9633
AT2G48020			Major facilitator superfamily ...		Lus10027975 [exp]	7.6	0.9403
AT5G16180		CRS1, ATCRS1	ARABIDOPSIS ORTHOLOG OF MAIZE ...		Lus10017618 [exp]	7.9	0.9397
AT5G12480		CPK7	calmodulin-domain protein kina...		Lus10033107 [exp]	8.0	0.9395
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10033743 [exp]	8.8	0.9609

Compare expression of checked genes

Lus10026081 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.