Lus10026098 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G30845 90 / 3e-24 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002320 202 / 2e-68 AT4G30845 86 / 2e-22 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G180200 93 / 6e-25 AT4G30845 112 / 2e-32 unknown protein
PFAM info
Representative CDS sequence
>Lus10026098 pacid=23173107 polypeptide=Lus10026098 locus=Lus10026098.g ID=Lus10026098.BGIv1.0 annot-version=v1.0
ATGGCTGCCATCGGCACCGGAGCCACCGTCTGCCAGATCAATTGCAGCATGCCGGGAAGAAAATGCTCAGTTTCATCTATGGTGCGATTCCATCCGAAGA
AATCAAAACCTTTGGCAGCAGCCAGAAGGAAGGACGACGGCGACGGCGACTACAGCGATTCATCACCGCAGCCTATGAAGCTTCCGATCGGAAAGCTTGT
GGCGAGCTCTGCCACGGTGGTGTTCGCGTTGGGATTCGTCGACGCGGGATACAGCGGGGATTGGTCGAGGATTGGAGCCATCTCGAATGAGACCGAAGAA
TTACTAAAGGTCGCGTCGTTTCTGGTCGTTCCTTTCTGCGTTTTGCTCGTCATCTCCATCTCCAAGACGGAAGTCGATTCTTGA
AA sequence
>Lus10026098 pacid=23173107 polypeptide=Lus10026098 locus=Lus10026098.g ID=Lus10026098.BGIv1.0 annot-version=v1.0
MAAIGTGATVCQINCSMPGRKCSVSSMVRFHPKKSKPLAAARRKDDGDGDYSDSSPQPMKLPIGKLVASSATVVFALGFVDAGYSGDWSRIGAISNETEE
LLKVASFLVVPFCVLLVISISKTEVDS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G30845 unknown protein Lus10026098 0 1
AT4G11130 SMD1, RDR2 SILENCING MOVEMENT DEFICIENT 1... Lus10002361 1.4 0.9423
AT2G38025 Cysteine proteinases superfami... Lus10027758 3.5 0.9224
AT4G15510 Photosystem II reaction center... Lus10000614 4.2 0.9398
AT4G37925 NdhM, NDH-M NADH dehydrogenase-like comple... Lus10042758 4.5 0.9215
AT1G47740 PPPDE putative thiol peptidase... Lus10003951 5.3 0.8884
AT3G26900 ATSKL1 Arabidopsis thaliana shikimate... Lus10035171 6.0 0.9287
AT3G52150 RNA-binding (RRM/RBD/RNP motif... Lus10041602 9.8 0.9189
AT5G54190 PORA protochlorophyllide oxidoreduc... Lus10032665 12.1 0.9135
AT3G26900 ATSKL1 Arabidopsis thaliana shikimate... Lus10032000 13.0 0.9079
AT1G60550 ECHID, DHNS enoyl-CoA hydratase/isomerase ... Lus10013023 13.4 0.8973

Lus10026098 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.