Lus10026127 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G09500 244 / 3e-84 Ribosomal protein S19 family protein (.1)
AT5G09490 230 / 1e-78 Ribosomal protein S19 family protein (.1)
AT5G09510 217 / 1e-73 Ribosomal protein S19 family protein (.1.2)
AT1G04270 217 / 2e-73 RPS15 cytosolic ribosomal protein S15 (.1.2)
AT5G43640 214 / 2e-72 Ribosomal protein S19 family protein (.1)
AT5G63070 174 / 1e-56 Ribosomal protein S19 family protein (.1)
AT1G33850 63 / 1e-13 Ribosomal protein S19 family protein (.1)
AT5G47320 47 / 8e-07 RPS19 ribosomal protein S19 (.1)
ATCG00820 40 / 5e-05 ATCG00820.1, RPS19 ribosomal protein S19 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007469 257 / 2e-89 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1)
Lus10033856 246 / 5e-85 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2)
Lus10018777 243 / 7e-84 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2)
Lus10041168 239 / 1e-80 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2)
Lus10021886 226 / 1e-74 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1)
Lus10008692 214 / 6e-73 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1)
Lus10024865 208 / 2e-70 AT5G09500 222 / 4e-76 Ribosomal protein S19 family protein (.1)
Lus10027711 50 / 3e-08 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1)
Lus10003009 48 / 1e-06 AT5G47040 1420 / 0.0 lon protease 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G043200 246 / 4e-85 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1)
Potri.005G219700 244 / 2e-84 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1)
Potri.010G076900 244 / 2e-84 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2)
Potri.008G161901 118 / 1e-35 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2)
Potri.005G055401 82 / 3e-21 AT1G04270 97 / 3e-27 cytosolic ribosomal protein S15 (.1.2)
Potri.005G055534 64 / 1e-13 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2)
Potri.003G123750 57 / 1e-11 AT1G04270 67 / 4e-16 cytosolic ribosomal protein S15 (.1.2)
Potri.004G074201 51 / 6e-09 AT5G09500 52 / 1e-09 Ribosomal protein S19 family protein (.1)
Potri.011G074301 45 / 9e-07 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1)
Potri.013G137688 45 / 1e-06 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00203 Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence
>Lus10026127 pacid=23173249 polypeptide=Lus10026127 locus=Lus10026127.g ID=Lus10026127.BGIv1.0 annot-version=v1.0
ATGGCGGAAGCAGATCAGGCTGCAGCAGTGGAGGTTCCCCTCCAGGCGAAGAAGAGCAGAACTTTCAAGCAGTTCAGCTACAGGGGAAAGGATTTGGATG
CCCTCCTCGACATGTCGACCGACGAGCTCGTCAAGCTGTTCCCTGCCCGAGCTAGGAGGAGGTTCCAGAGAGGTCTCACCAGGAAGCCCATGGCCTTCAT
CAAGAAGCTTCGCACCGCCAAGCGAAACGCTCCTCCAGGTGAGAAGCCGGCGGTGGTGAGGACCCACTTGAGGGACATGATCATCGTGCCCGAAATGATC
GGAAGCGTAGTCGGGGTGTACAACGGGAAGACGTTTGTTCAGTACGAGGTGAAGCCGGAGATGATCGGTCACTACTTGGCCGAGTTTGCTATCACGTACA
AGCCAGTGAGCCACGGGAGACCCGGTATGGGTGCTACCAACTCTTCGAGGTTCATTCCTCTCAAATGA
AA sequence
>Lus10026127 pacid=23173249 polypeptide=Lus10026127 locus=Lus10026127.g ID=Lus10026127.BGIv1.0 annot-version=v1.0
MAEADQAAAVEVPLQAKKSRTFKQFSYRGKDLDALLDMSTDELVKLFPARARRRFQRGLTRKPMAFIKKLRTAKRNAPPGEKPAVVRTHLRDMIIVPEMI
GSVVGVYNGKTFVQYEVKPEMIGHYLAEFAITYKPVSHGRPGMGATNSSRFIPLK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G09500 Ribosomal protein S19 family p... Lus10026127 0 1
AT5G51105 Protein of unknown function (D... Lus10043285 8.1 0.8543
AT1G21130 IGMT4 indole glucosinolate O-methylt... Lus10030187 11.8 0.8393
AT3G12500 PR-3, PR3, CHI-... PATHOGENESIS-RELATED 3, basic ... Lus10041829 13.2 0.8127
Lus10025477 17.7 0.7942
AT1G51190 AP2_ERF PLT2 PLETHORA 2, Integrase-type DNA... Lus10040501 19.7 0.7934
AT4G38540 FAD/NAD(P)-binding oxidoreduct... Lus10033364 21.4 0.7896
AT4G35220 Cyclase family protein (.1) Lus10027872 23.4 0.7875
Lus10025268 25.0 0.7865
AT4G30380 EXLB2 Barwin-related endoglucanase (... Lus10026232 26.5 0.7865
AT5G06720 ATPA2 peroxidase 2 (.1) Lus10027988 27.9 0.7865

Lus10026127 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.