Lus10026133 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12390 205 / 2e-68 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
AT5G13850 191 / 4e-63 NACA3 nascent polypeptide-associated complex subunit alpha-like protein 3 (.1)
AT4G10480 187 / 1e-61 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1), Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.2)
AT3G49470 181 / 8e-59 NACA2 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
AT1G33040 172 / 2e-55 NACA5 nascent polypeptide-associated complex subunit alpha-like protein 5 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008687 245 / 1e-81 AT3G15660 197 / 7e-62 A. THALIANA GLUTAREDOXIN 4, glutaredoxin 4 (.1.2)
Lus10041610 232 / 3e-79 AT3G12390 229 / 7e-77 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10024109 229 / 6e-79 AT3G12390 198 / 1e-65 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Lus10032927 179 / 4e-58 AT3G49470 260 / 2e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Lus10015579 179 / 4e-58 AT3G49470 260 / 1e-88 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G034400 239 / 4e-82 AT3G12390 204 / 5e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.003G190800 239 / 6e-82 AT3G12390 204 / 7e-67 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.006G032000 221 / 1e-74 AT3G12390 215 / 2e-71 Nascent polypeptide-associated complex (NAC), alpha subunit family protein (.1)
Potri.015G003300 186 / 7e-61 AT3G49470 172 / 4e-54 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
Potri.012G006700 172 / 2e-55 AT3G49470 171 / 1e-53 nascent polypeptide-associated complex subunit alpha-like protein 2 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01849 NAC NAC domain
CL0214 UBA PF00627 UBA UBA/TS-N domain
Representative CDS sequence
>Lus10026133 pacid=23173149 polypeptide=Lus10026133 locus=Lus10026133.g ID=Lus10026133.BGIv1.0 annot-version=v1.0
ATGTTGAAGTTGGGAATGAAGCCCATGACCGGCGTCAGTCGAGTTACTGTCAAGAAGAGCAAGAATATCTTGTTCGTGATCTCAAAACCGGACGTGTTCA
AGAGCCCAACATCGGACACATACATCATCTTCGGAGAGGCCAAGATCGAAGACATCAGCTCGCAGCTACAAAGCCAAGCAGCAGAGCAGTTCAAGGCCCC
TGATCTGAGCCATATGATCTCGAAACCAGAGACCTCTGGCATGGCTCAGGACAATGAGGAGGTGGATGAAACTGGAGTCGAATCAAAGGACATTGAATTA
GTTATGACACAGGCGGGAGTCTCGAGGCCTAAAGCCGTGAGGGCTCTCAAGGCTGCAGATGGGGACATTGTATCTGCAATCATGGAACTTACCACCTGA
AA sequence
>Lus10026133 pacid=23173149 polypeptide=Lus10026133 locus=Lus10026133.g ID=Lus10026133.BGIv1.0 annot-version=v1.0
MLKLGMKPMTGVSRVTVKKSKNILFVISKPDVFKSPTSDTYIIFGEAKIEDISSQLQSQAAEQFKAPDLSHMISKPETSGMAQDNEEVDETGVESKDIEL
VMTQAGVSRPKAVRALKAADGDIVSAIMELTT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12390 Nascent polypeptide-associated... Lus10026133 0 1
AT3G59650 mitochondrial ribosomal protei... Lus10006114 1.0 0.9005
AT5G20180 Ribosomal protein L36 (.1.2) Lus10019412 2.6 0.8232
AT2G35605 SWIB/MDM2 domain superfamily p... Lus10033312 3.7 0.7877
AT2G31490 unknown protein Lus10027603 3.9 0.8332
AT4G30220 RUXF small nuclear ribonucleoprotei... Lus10037606 5.7 0.8581
AT5G46920 Intron maturase, type II famil... Lus10003019 6.9 0.7971
AT1G11240 unknown protein Lus10018438 6.9 0.8489
AT1G05205 unknown protein Lus10027173 7.7 0.8521
AT2G20490 NOP10, EDA27 EMBRYO SAC DEVELOPMENT ARREST ... Lus10033907 8.5 0.8174
AT1G47278 unknown protein Lus10040837 9.8 0.7444

Lus10026133 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.