Lus10026138 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02340 157 / 3e-48 alpha/beta-Hydrolases superfamily protein (.1)
AT4G15955 137 / 5e-42 alpha/beta-Hydrolases superfamily protein (.1.2.3)
AT2G26740 135 / 2e-39 ATSEH soluble epoxide hydrolase (.1)
AT2G26750 134 / 2e-39 alpha/beta-Hydrolases superfamily protein (.1)
AT4G15960 135 / 4e-39 alpha/beta-Hydrolases superfamily protein (.1)
AT3G05600 126 / 5e-36 alpha/beta-Hydrolases superfamily protein (.1)
AT3G51000 114 / 3e-31 alpha/beta-Hydrolases superfamily protein (.1)
AT4G33180 43 / 1e-05 alpha/beta-Hydrolases superfamily protein (.1)
AT1G52510 40 / 0.0002 alpha/beta-Hydrolases superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026140 216 / 7e-72 AT4G02340 329 / 2e-113 alpha/beta-Hydrolases superfamily protein (.1)
Lus10008683 205 / 6e-67 AT4G02340 428 / 1e-151 alpha/beta-Hydrolases superfamily protein (.1)
Lus10026141 192 / 1e-61 AT4G02340 446 / 6e-159 alpha/beta-Hydrolases superfamily protein (.1)
Lus10004439 181 / 1e-57 AT4G02340 384 / 3e-134 alpha/beta-Hydrolases superfamily protein (.1)
Lus10010293 167 / 6e-52 AT4G02340 476 / 1e-170 alpha/beta-Hydrolases superfamily protein (.1)
Lus10037577 143 / 1e-42 AT4G02340 384 / 6e-134 alpha/beta-Hydrolases superfamily protein (.1)
Lus10006827 142 / 2e-42 AT4G02340 380 / 8e-133 alpha/beta-Hydrolases superfamily protein (.1)
Lus10038649 136 / 8e-40 AT4G15960 420 / 1e-147 alpha/beta-Hydrolases superfamily protein (.1)
Lus10020663 134 / 3e-39 AT3G05600 416 / 1e-146 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G127200 175 / 3e-55 AT4G02340 519 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.002G202700 172 / 7e-54 AT4G02340 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G081000 163 / 2e-50 AT4G02340 455 / 1e-161 alpha/beta-Hydrolases superfamily protein (.1)
Potri.013G013500 148 / 1e-44 AT3G05600 425 / 2e-150 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010800 146 / 1e-43 AT4G15960 413 / 1e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010900 145 / 3e-43 AT4G15960 412 / 3e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010700 144 / 3e-43 AT4G15960 404 / 2e-141 alpha/beta-Hydrolases superfamily protein (.1)
Potri.007G018900 124 / 2e-35 AT3G51000 454 / 9e-162 alpha/beta-Hydrolases superfamily protein (.1)
Potri.014G127101 108 / 1e-31 AT4G02340 155 / 7e-48 alpha/beta-Hydrolases superfamily protein (.1)
Potri.011G048000 111 / 2e-30 AT3G51000 219 / 2e-69 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Representative CDS sequence
>Lus10026138 pacid=23173297 polypeptide=Lus10026138 locus=Lus10026138.g ID=Lus10026138.BGIv1.0 annot-version=v1.0
ATGGAGAAAATAGAGCACACAACGGTACCAGCAAACGGCCTAAACATCCACGTGGCGTCCACCGGCGCCGGAACCCGGACAATCCTCTTCCTCCACGGAT
TCCCACAGCTGTGGTACTCGTGGCGGCACCAGCTCATCTCCCTCTCCTCCTTCGGCTACCGCTGCATCGCTCCCGACCTCCGCGGCTACGGCGACACTAC
GGTTGACGTCGGCGCGTCTCCTTCCTCCTCCGCCGCCGCCTTCACTTCCTTCCATGTGGTTGGAGATCTCGTCGCCCTCCTTGACGCTCTGAAGATCCAG
CAGGTATTCTTGGTGGGCCACGACTGGGGGGCCACCATAGCGTGGCATTTCTGTCTTTTCCGGCCGGATAGGGTCGAGGCTCTGGTCAACACCAGTGTCC
CGTTTCGTCCCAGGTGA
AA sequence
>Lus10026138 pacid=23173297 polypeptide=Lus10026138 locus=Lus10026138.g ID=Lus10026138.BGIv1.0 annot-version=v1.0
MEKIEHTTVPANGLNIHVASTGAGTRTILFLHGFPQLWYSWRHQLISLSSFGYRCIAPDLRGYGDTTVDVGASPSSSAAAFTSFHVVGDLVALLDALKIQ
QVFLVGHDWGATIAWHFCLFRPDRVEALVNTSVPFRPR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02340 alpha/beta-Hydrolases superfam... Lus10026138 0 1
AT5G38195 Bifunctional inhibitor/lipid-t... Lus10017615 3.2 0.9223
AT3G51680 AtSDR2 short-chain dehydrogenase/redu... Lus10016175 5.9 0.9279
AT2G43610 Chitinase family protein (.1) Lus10001772 14.1 0.9207
AT3G47570 Leucine-rich repeat protein ki... Lus10035724 17.7 0.9087
AT3G03000 EF hand calcium-binding protei... Lus10004539 20.0 0.9082
Lus10041024 22.3 0.9062
AT3G03080 Zinc-binding dehydrogenase fam... Lus10003638 23.5 0.9060
AT1G75750 GASA1 GAST1 protein homolog 1 (.1.2) Lus10034524 25.8 0.9026
AT4G03220 Protein with RNI-like/FBD-like... Lus10023567 28.1 0.9024
Lus10009618 29.7 0.9024

Lus10026138 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.