Lus10026139 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G15960 102 / 5e-27 alpha/beta-Hydrolases superfamily protein (.1)
AT4G02340 95 / 2e-24 alpha/beta-Hydrolases superfamily protein (.1)
AT4G15955 90 / 8e-23 alpha/beta-Hydrolases superfamily protein (.1.2.3)
AT3G05600 89 / 2e-22 alpha/beta-Hydrolases superfamily protein (.1)
AT2G26740 79 / 9e-19 ATSEH soluble epoxide hydrolase (.1)
AT2G26750 78 / 2e-18 alpha/beta-Hydrolases superfamily protein (.1)
AT3G51000 60 / 1e-11 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008683 143 / 4e-43 AT4G02340 428 / 1e-151 alpha/beta-Hydrolases superfamily protein (.1)
Lus10008682 112 / 6e-33 AT4G02340 148 / 1e-44 alpha/beta-Hydrolases superfamily protein (.1)
Lus10008684 108 / 6e-30 AT4G02340 369 / 1e-128 alpha/beta-Hydrolases superfamily protein (.1)
Lus10026141 105 / 2e-28 AT4G02340 446 / 6e-159 alpha/beta-Hydrolases superfamily protein (.1)
Lus10004439 101 / 5e-27 AT4G02340 384 / 3e-134 alpha/beta-Hydrolases superfamily protein (.1)
Lus10009859 87 / 4e-22 AT4G02340 349 / 6e-122 alpha/beta-Hydrolases superfamily protein (.1)
Lus10010293 87 / 2e-21 AT4G02340 476 / 1e-170 alpha/beta-Hydrolases superfamily protein (.1)
Lus10020663 87 / 2e-21 AT3G05600 416 / 1e-146 alpha/beta-Hydrolases superfamily protein (.1)
Lus10029878 87 / 2e-21 AT3G05600 425 / 3e-150 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G202700 98 / 7e-26 AT4G02340 513 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.014G127200 98 / 9e-26 AT4G02340 519 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.013G013500 93 / 7e-24 AT3G05600 425 / 2e-150 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010800 92 / 2e-23 AT4G15960 413 / 1e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010900 90 / 8e-23 AT4G15960 412 / 3e-144 alpha/beta-Hydrolases superfamily protein (.1)
Potri.010G010700 90 / 1e-22 AT4G15960 404 / 2e-141 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G081000 81 / 2e-19 AT4G02340 455 / 1e-161 alpha/beta-Hydrolases superfamily protein (.1)
Potri.007G018900 57 / 1e-10 AT3G51000 454 / 9e-162 alpha/beta-Hydrolases superfamily protein (.1)
Potri.005G023400 55 / 3e-10 AT3G05600 238 / 8e-79 alpha/beta-Hydrolases superfamily protein (.1)
Potri.011G048000 51 / 1e-08 AT3G51000 219 / 2e-69 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10026139 pacid=23173194 polypeptide=Lus10026139 locus=Lus10026139.g ID=Lus10026139.BGIv1.0 annot-version=v1.0
ATGGGTTTATCAATAGTTGCAGGCAGACCCGAGTGCGACAAAGATTGTTGCATGCAATCTACTTTTTTGTTGTACTCAACTCTAAGGACATGGGAGACGA
TGGCGGCCTGGACGGGGGCGAAAGTGATGGTGCCGACGAAGTTCGTTGCAGGGGAGCTAGACTTGACGCTGAAGTTTCCCGGAACGGAGGAATACATCAA
TGGCGGAGGGTTCAAAGAATATGTGCCGTTGCTGGAGGAGGTTGTTTTGCTGAAAGATGTGGGACACTTTCTCATTGAAGAGAGCCCAGAGGAAGTCACC
AAACACATCTACGATTTCTTCAACAAGTTTTAA
AA sequence
>Lus10026139 pacid=23173194 polypeptide=Lus10026139 locus=Lus10026139.g ID=Lus10026139.BGIv1.0 annot-version=v1.0
MGLSIVAGRPECDKDCCMQSTFLLYSTLRTWETMAAWTGAKVMVPTKFVAGELDLTLKFPGTEEYINGGGFKEYVPLLEEVVLLKDVGHFLIEESPEEVT
KHIYDFFNKF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G15960 alpha/beta-Hydrolases superfam... Lus10026139 0 1

Lus10026139 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.