Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G06990 87 / 9e-23 Protein of unknown function, DUF617 (.1) AT4G39610 86 / 2e-22 Protein of unknown function, DUF617 (.1) AT2G21990 84 / 1e-21 Protein of unknown function, DUF617 (.1) AT2G41660 76 / 2e-18 MIZ1 mizu-kussei 1, Protein of unknown function, DUF617 (.1) AT3G25640 72 / 4e-17 Protein of unknown function, DUF617 (.1) AT5G23100 71 / 1e-16 Protein of unknown function, DUF617 (.1) AT5G42680 64 / 2e-14 Protein of unknown function, DUF617 (.1.2) AT2G37880 62 / 1e-13 Protein of unknown function, DUF617 (.1) AT1G21050 61 / 7e-13 Protein of unknown function, DUF617 (.1) AT1G76610 57 / 1e-11 Protein of unknown function, DUF617 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008672 [exp] 105 / 2e-30 AT5G06990 162 / 5e-54 Protein of unknown function, DUF617 (.1) Lus10036630 [exp] 81 / 5e-20 AT4G39610 308 / 5e-105 Protein of unknown function, DUF617 (.1) Lus10035847 [exp] 80 / 1e-19 AT2G21990 306 / 1e-104 Protein of unknown function, DUF617 (.1) Lus10021759 [exp] 78 / 4e-19 AT5G42680 254 / 3e-85 Protein of unknown function, DUF617 (.1.2) Lus10031059 [exp] 77 / 2e-18 AT2G41660 258 / 4e-85 mizu-kussei 1, Protein of unknown function, DUF617 (.1) Lus10035443 [exp] 76 / 3e-18 AT2G41660 248 / 4e-81 mizu-kussei 1, Protein of unknown function, DUF617 (.1) Lus10019166 [exp] 75 / 5e-18 AT3G25640 258 / 2e-86 Protein of unknown function, DUF617 (.1) Lus10038951 [exp] 69 / 7e-17 AT5G23100 159 / 1e-49 Protein of unknown function, DUF617 (.1) Lus10000863 [exp] 70 / 3e-16 AT5G23100 276 / 3e-93 Protein of unknown function, DUF617 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G084000 [exp] 87 / 7e-23 AT2G21990 327 / 4e-114 Protein of unknown function, DUF617 (.1) Potri.001G031900 [exp] 87 / 1e-22 AT5G06990 275 / 6e-93 Protein of unknown function, DUF617 (.1) Potri.003G193700 [exp] 86 / 3e-22 AT5G06990 328 / 6e-114 Protein of unknown function, DUF617 (.1) Potri.016G056800 [exp] 81 / 3e-20 AT2G41660 202 / 6e-64 mizu-kussei 1, Protein of unknown function, DUF617 (.1) Potri.006G048800 [exp] 79 / 2e-19 AT2G41660 241 / 3e-79 mizu-kussei 1, Protein of unknown function, DUF617 (.1) Potri.002G128800 [exp] 75 / 3e-18 AT5G42680 269 / 2e-91 Protein of unknown function, DUF617 (.1.2) Potri.012G058300 [exp] 74 / 5e-18 AT5G23100 261 / 7e-88 Protein of unknown function, DUF617 (.1) Potri.014G035000 [exp] 74 / 7e-18 AT5G42680 286 / 2e-98 Protein of unknown function, DUF617 (.1.2) Potri.015G053000 [exp] 74 / 7e-18 AT5G23100 293 / 3e-100 Protein of unknown function, DUF617 (.1) Potri.010G131600 [exp] 74 / 8e-18 AT3G25640 249 / 1e-82 Protein of unknown function, DUF617 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04759 [flax] [poplar] DUF617 Protein of unknown function, DUF617
Representative CDS sequence Show only first row Show all	>Lus10026148 pacid=23173301 polypeptide=Lus10026148 locus=Lus10026148.g ID=Lus10026148.BGIv1.0 annot-version=v1.0 ATGGCGTGGGGCGCGGGATTGATCCCGGAGAGGGACGCCGGCGGCGGCGGTGGGGGGATCCATCCGGACGGGGAGATGGCGTATATGAGGGCGCATTTCG AGCGGGTTGTCGGGTCGAGAGACTCCGAAACGTATTATATGATGAACCCGGATGGGAATAGCGGTCCGGAGTTAAGCATTTTCTTTGTCAGGGTTTGA
AA sequence Show only first row Show all	>Lus10026148 pacid=23173301 polypeptide=Lus10026148 locus=Lus10026148.g ID=Lus10026148.BGIv1.0 annot-version=v1.0 MAWGAGLIPERDAGGGGGGIHPDGEMAYMRAHFERVVGSRDSETYYMMNPDGNSGPELSIFFVRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G21990			Protein of unknown function, D...		Lus10026148 [exp]	0	1
AT1G28220		ATPUP3	purine permease 3 (.1)		Lus10026807 [exp]	2.0	0.7602
AT1G15960		ATNRAMP6, NRAMP...	NRAMP metal ion transporter 6 ...		Lus10018132 [exp]	4.0	0.8190
					Lus10039269 [exp]	8.7	0.7146
					Lus10003695 [exp]	9.9	0.7237
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10008978 [exp]	11.5	0.7237
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040724 [exp]	12.8	0.7237
					Lus10020958 [exp]	14.1	0.7237
					Lus10021906 [exp]	15.2	0.7237
AT4G35700	C2H2ZnF	DAZ3	DUO1-activated zinc finger 3, ...		Lus10041633 [exp]	16.2	0.7237
AT4G35260		IDH-I, IDH1	isocitrate dehydrogenase I, is...		Lus10014436 [exp]	17.2	0.7237

Compare expression of checked genes

Lus10026148 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.