Lus10026163 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G12260 200 / 2e-67 LYR family of Fe/S cluster biogenesis protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008661 158 / 1e-49 AT3G12260 108 / 8e-30 LYR family of Fe/S cluster biogenesis protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G029900 192 / 2e-64 AT3G12260 177 / 2e-58 LYR family of Fe/S cluster biogenesis protein (.1)
PFAM info
Representative CDS sequence
>Lus10026163 pacid=23173091 polypeptide=Lus10026163 locus=Lus10026163.g ID=Lus10026163.BGIv1.0 annot-version=v1.0
ATGGAGAGGGCCGCAGCAGCATCGTTGAAGTTCGTGAAAGTACCGCCGAACTCCGCGAGCATGGAGGAGGCGAGGGCTAGGGTTTTCGAATTCTTCAAAA
CTGCCTGCAGATCCGTCCCCACGATCATGGACATCTACAATCTCCAGGACGTCGTCAAGGAGTCTCAGCTCCGTTCCTCCGTCGCTTCCGAGATCCGCAG
GCACGCTCACATCACCGACCCCAAGGTGATTGATATGCTGCTGCTGAAAGGGACAGAAGAGTTGAGCAACGTTGTGCAGCACTCGAAGCAGCGGCACCAC
ATCATCGGACAGTACGTAGTGGGGAAACAAGGACTCGTGCAGGATTTGGGAACCAAGGATGAAGGAGCCTCCGATTTTCTCAAGAACTTCTACAAAACCA
ACTACTTCTGA
AA sequence
>Lus10026163 pacid=23173091 polypeptide=Lus10026163 locus=Lus10026163.g ID=Lus10026163.BGIv1.0 annot-version=v1.0
MERAAAASLKFVKVPPNSASMEEARARVFEFFKTACRSVPTIMDIYNLQDVVKESQLRSSVASEIRRHAHITDPKVIDMLLLKGTEELSNVVQHSKQRHH
IIGQYVVGKQGLVQDLGTKDEGASDFLKNFYKTNYF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G12260 LYR family of Fe/S cluster bio... Lus10026163 0 1
AT3G56490 HIT3, HINT1 HISTIDINE TRIAD NUCLEOTIDE-BIN... Lus10035409 3.2 0.9123
AT4G30010 unknown protein Lus10025458 6.6 0.8785
AT3G47810 ATVPS29, MAG1 VACUOLAR PROTEIN SORTING 29, M... Lus10030497 7.5 0.8994
AT4G37830 cytochrome c oxidase-related (... Lus10019250 12.1 0.9013
AT1G78310 VQ motif-containing protein (.... Lus10036480 14.1 0.8860
AT5G16880 Target of Myb protein 1 (.1.2.... Lus10005924 15.8 0.8821
AT2G43970 RNA-binding protein (.1.2) Lus10025608 17.5 0.8837
AT5G27430 Signal peptidase subunit (.1) Lus10004463 17.5 0.8893
AT4G30010 unknown protein Lus10001443 18.7 0.8762
AT2G42210 ATOEP16-3 Mitochondrial import inner mem... Lus10016278 21.6 0.8729

Lus10026163 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.