Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G56710 44 / 2e-06 SIB1 sigma factor binding protein 1 (.1) AT2G41180 44 / 4e-06 SIB2 sigma factor binding protein 2, VQ motif-containing protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008659 [exp] 193 / 5e-65 ND 44 / 4e-06 Lus10039494 [exp] 77 / 2e-18 AT3G56710 56 / 3e-10 sigma factor binding protein 1 (.1) Lus10039493 [exp] 76 / 5e-18 AT3G56710 54 / 1e-09 sigma factor binding protein 1 (.1) Lus10024139 [exp] 74 / 2e-17 AT3G56710 58 / 5e-11 sigma factor binding protein 1 (.1) Lus10038985 [exp] 47 / 5e-07 AT3G56710 54 / 3e-09 sigma factor binding protein 1 (.1) Lus10027279 [exp] 44 / 7e-06 AT3G56710 46 / 2e-06 sigma factor binding protein 1 (.1) Lus10022005 [exp] 41 / 4e-05 AT3G56710 48 / 1e-07 sigma factor binding protein 1 (.1) Lus10005523 [exp] 40 / 8e-05 ND 46 / 2e-06 Lus10006569 [exp] 39 / 0.0004 ND 44 / 1e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G029700 [exp] 63 / 1e-13 AT3G56710 54 / 5e-10 sigma factor binding protein 1 (.1) Potri.003G194700 [exp] 63 / 2e-13 AT3G56710 54 / 6e-10 sigma factor binding protein 1 (.1) Potri.006G038900 [exp] 47 / 2e-07 AT2G41180 56 / 2e-10 sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.016G036600 [exp] 43 / 5e-06 AT3G56710 48 / 2e-07 sigma factor binding protein 1 (.1) Potri.016G093900 [exp] 43 / 6e-06 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.019G013750 [exp] 43 / 6e-06 AT3G56710 46 / 7e-07 sigma factor binding protein 1 (.1) Potri.019G013300 [exp] 42 / 7e-06 AT2G41180 47 / 3e-07 sigma factor binding protein 2, VQ motif-containing protein (.1) Potri.013G043800 [exp] 42 / 2e-05 AT2G41180 / sigma factor binding protein 2, VQ motif-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05678 [flax] [poplar] VQ VQ motif
Representative CDS sequence Show only first row Show all	>Lus10026165 pacid=23173109 polypeptide=Lus10026165 locus=Lus10026165.g ID=Lus10026165.BGIv1.0 annot-version=v1.0 ATGAAGAACAGAAGAGCTCCAGGTAGCAGGCGGGAGATGAGAAGGGATGTACTGAAAGTTGTGTACATTTCAACTCCAATGAAGGTGACAACGACGGAGG CCGAGTTCAAGAATCTGGTCCAAGAGCTCACCGGGAAAGATTCCGATACGGCCAGGCTGATGGAGCAGCAGCAGGACTTCAACTTGATGATGATGGAGGA AGAAGCAACAGCTAAGAGTGATCATGCTCAGGCCGGTACGTGGACCAGTTCAGATAGTACAACGACGTCGGGTTTGGATGCATTTGATGAGTATGATCAT CAAGGGTTGTTCATGAGCATGGTTCAGTCGAGTTTTTTTGATGACTTGGGTCAATTTGATGCCTTTAATGGTTAG
AA sequence Show only first row Show all	>Lus10026165 pacid=23173109 polypeptide=Lus10026165 locus=Lus10026165.g ID=Lus10026165.BGIv1.0 annot-version=v1.0 MKNRRAPGSRREMRRDVLKVVYISTPMKVTTTEAEFKNLVQELTGKDSDTARLMEQQQDFNLMMMEEEATAKSDHAQAGTWTSSDSTTTSGLDAFDEYDH QGLFMSMVQSSFFDDLGQFDAFNG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G56710		SIB1	sigma factor binding protein 1...		Lus10026165 [exp]	0	1
AT5G15630		IRX6, COBL4	IRREGULAR XYLEM 6, COBRA-LIKE4...		Lus10021142 [exp]	2.6	0.9791
					Lus10036765 [exp]	3.7	0.9791
AT1G26480		GF14IOTA, GRF12	general regulatory factor 12 (...		Lus10004652 [exp]	4.5	0.9634
AT2G16190			unknown protein		Lus10011284 [exp]	4.6	0.9791
AT3G54200			Late embryogenesis abundant (L...		Lus10031554 [exp]	5.3	0.9791
AT4G27570			UDP-Glycosyltransferase superf...		Lus10039236 [exp]	5.5	0.9511
					Lus10006395 [exp]	5.9	0.9791
					Lus10002859 [exp]	6.5	0.9667
AT2G13600			Pentatricopeptide repeat (PPR)...		Lus10026811 [exp]	8.1	0.9694
AT3G55500		ATHEXPALPHA1.7,...	EXPANSIN 16, expansin A16 (.1)		Lus10014406 [exp]	8.5	0.9642

Compare expression of checked genes

Lus10026165 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.