Lus10026169 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G05200 51 / 3e-08 CRK25 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
AT4G21400 42 / 4e-05 CRK28 cysteine-rich RLK (RECEPTOR-like protein kinase) 28 (.1)
AT4G38830 40 / 0.0001 CRK26 cysteine-rich RLK (RECEPTOR-like protein kinase) 26 (.1)
AT4G23280 40 / 0.0002 CRK20 cysteine-rich RLK (RECEPTOR-like protein kinase) 20 (.1)
AT4G21410 40 / 0.0002 CRK29 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
AT3G21940 40 / 0.0003 Receptor protein kinase-related (.1)
AT4G21230 40 / 0.0003 CRK27 cysteine-rich RLK (RECEPTOR-like protein kinase) 27 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008656 161 / 5e-52 AT4G05200 44 / 8e-06 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10026168 81 / 1e-19 ND 37 / 0.005
Lus10018380 58 / 2e-10 AT4G05200 324 / 2e-104 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10026629 51 / 5e-08 AT4G23180 540 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10018382 49 / 3e-07 AT4G21410 605 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Lus10026810 47 / 3e-07 AT1G63600 41 / 1e-04 Receptor-like protein kinase-related family protein (.1)
Lus10018379 46 / 3e-06 AT4G23180 566 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Lus10018377 45 / 4e-06 AT4G05200 489 / 4e-164 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Lus10007632 45 / 6e-06 AT4G05200 624 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G208400 55 / 3e-10 AT5G48540 52 / 1e-08 receptor-like protein kinase-related family protein (.1)
Potri.004G026350 49 / 2e-07 AT4G21410 610 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.011G028600 47 / 1e-06 AT4G21410 554 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.011G029300 45 / 3e-06 AT4G21410 539 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.011G030300 45 / 3e-06 AT4G21410 533 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.011G030212 45 / 3e-06 AT4G21410 537 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 29 (.1)
Potri.004G025200 45 / 4e-06 AT4G23180 665 / 0.0 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G024900 45 / 4e-06 AT4G23180 506 / 1e-171 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G025900 45 / 4e-06 AT4G23130 573 / 0.0 RECEPTOR-LIKE PROTEIN KINASE 6, cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 5 (.2)
Potri.011G029900 44 / 4e-06 AT4G05200 112 / 1e-29 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10026169 pacid=23173233 polypeptide=Lus10026169 locus=Lus10026169.g ID=Lus10026169.BGIv1.0 annot-version=v1.0
ATGAAAGCAACAATATTATTATTACTACTATTATCATGTGCAGGAAGCTGGAGTACTACGGTCGTTTTGTGCCAAGATGAATTTCAACCCATAGGAGTTC
CACTCTGCAACCTGAAGAAGATACATAAGGGTGACCCGTTCGCCGGCGCACTGGCGGATGCTCTGAAGACGATATGGATCCATGTGGGCGAGCTGGTGGG
AGATCCTTCTCACGAACACTGCTACGAAGGTCATGATAAAGACCAGCTTGTTACTGCGTACGGTTCGGCGTCTTGCGCCGAACGCCTTACCGATGAAGAT
TGTAGGGATAGCTTGAACGAAGCGTTGGGTCTAATTAGTAATGAATGTGGGAGTACTTACGGGGCTCAAGTCGCCACTCCCACCTGTTCCTTGAGGTTCG
AGGCTTACCGTTTCTGCTAG
AA sequence
>Lus10026169 pacid=23173233 polypeptide=Lus10026169 locus=Lus10026169.g ID=Lus10026169.BGIv1.0 annot-version=v1.0
MKATILLLLLLSCAGSWSTTVVLCQDEFQPIGVPLCNLKKIHKGDPFAGALADALKTIWIHVGELVGDPSHEHCYEGHDKDQLVTAYGSASCAERLTDED
CRDSLNEALGLISNECGSTYGAQVATPTCSLRFEAYRFC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G05200 CRK25 cysteine-rich RLK (RECEPTOR-li... Lus10026169 0 1
AT1G16930 F-box/RNI-like/FBD-like domain... Lus10023036 1.7 1.0000
AT1G06340 Plant Tudor-like protein (.1) Lus10039027 2.4 1.0000
AT5G36220 CYP91A1, CYP81D... CYTOCHROME P450 91A1, cytochro... Lus10018718 3.0 1.0000
AT2G44220 Protein of Unknown Function (D... Lus10006862 4.0 1.0000
AT4G26466 LRE lorelei (.1) Lus10011066 4.5 0.9188
AT5G28823 unknown protein Lus10040056 4.9 0.8646
AT3G60680 Plant protein of unknown funct... Lus10034935 5.3 0.8332
AT5G25180 CYP71B14 "cytochrome P450, family 71, s... Lus10024331 5.7 0.8273
AT4G25950 VATG3 vacuolar ATP synthase G3 (.1) Lus10009452 6.7 0.8222
Lus10011438 7.1 0.8093

Lus10026169 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.