Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G08315 107 / 4e-29 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008655 [exp] 213 / 1e-70 AT1G08315 393 / 5e-138 ARM repeat superfamily protein (.1) Lus10024145 [exp] 174 / 6e-55 AT1G08315 390 / 2e-136 ARM repeat superfamily protein (.1) Lus10039500 [exp] 172 / 1e-51 AT1G08315 383 / 2e-129 ARM repeat superfamily protein (.1) Lus10006007 [exp] 97 / 3e-26 AT1G08315 111 / 8e-30 ARM repeat superfamily protein (.1) Lus10007511 [exp] 44 / 6e-06 AT3G46510 397 / 2e-129 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1) Lus10032023 [exp] 41 / 5e-05 AT2G23140 309 / 1e-98 RING/U-box superfamily protein with ARM repeat domain (.1.2) Lus10017444 [exp] 39 / 0.0003 AT3G46510 381 / 2e-123 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G028300 [exp] 135 / 4e-40 AT1G08315 343 / 3e-118 ARM repeat superfamily protein (.1) Potri.003G195400 [exp] 131 / 2e-38 AT1G08315 364 / 1e-126 ARM repeat superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF00514 [flax] [poplar] Arm Armadillo/beta-catenin-like repeat
Representative CDS sequence Show only first row Show all	>Lus10026170 pacid=23173304 polypeptide=Lus10026170 locus=Lus10026170.g ID=Lus10026170.BGIv1.0 annot-version=v1.0 ATGTTGGAGGATGCGAGGGCGGTGATTGCTCAGATCGCCGGATGCGAGGAGAGTGAATCGGAATTCCGCAGAGTATCAGGAATTAGAGTTTTGGTGGATT TGTTGGATTCTGGGACGGGATCCAGCGATCGGATTAAGGAGAACACCGTCGGAGCGTTACTGAACCTGGCGAGGATCGGCGGGGAGAAGGTGAAAGGAGA AGTGAAGGAATTGGGAGCTACGGTGGTGGAGGGAATCAGAGATGTAGCGGAGACAGGGAGCTCTAAAGGGAAGAATAAAGCTATGGCGTTGCTGGTACTG ATCGAAGGCGGATCCATGAACGGGAACGAGAACTTCTATTACTCTTCGTGA
AA sequence Show only first row Show all	>Lus10026170 pacid=23173304 polypeptide=Lus10026170 locus=Lus10026170.g ID=Lus10026170.BGIv1.0 annot-version=v1.0 MLEDARAVIAQIAGCEESESEFRRVSGIRVLVDLLDSGTGSSDRIKENTVGALLNLARIGGEKVKGEVKELGATVVEGIRDVAETGSSKGKNKAMALLVL IEGGSMNGNENFYYSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G08315			ARM repeat superfamily protein...		Lus10026170 [exp]	0	1
AT2G23320	WRKY	WRKY15	WRKY DNA-binding protein 15 (....		Lus10006261 [exp]	4.5	0.8431
AT1G03290			unknown protein		Lus10012382 [exp]	8.1	0.8553
AT4G32600			RING/U-box superfamily protein...		Lus10008106 [exp]	8.4	0.8026
AT5G16110			unknown protein		Lus10028474 [exp]	10.8	0.8442
AT5G54680	bHLH	bHLH105, ILR3	iaa-leucine resistant3, basic ...		Lus10020069 [exp]	11.7	0.8492
AT2G21620		RD2	Adenine nucleotide alpha hydro...		Lus10026346 [exp]	19.9	0.8161
AT5G63140		ATPAP29, PAP29	purple acid phosphatase 29 (.1...		Lus10010289 [exp]	23.3	0.7868
AT2G23460		ATXLG1, XLG1	extra-large G-protein 1 (.1)		Lus10021012 [exp]	28.6	0.8209
AT2G42130			Plastid-lipid associated prote...		Lus10012003 [exp]	31.4	0.8365
					Lus10018551 [exp]	32.2	0.7676

Compare expression of checked genes

Lus10026170 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.