Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G58170 207 / 1e-68 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G55210 194 / 2e-63 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) AT5G49040 189 / 3e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13650 182 / 1e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT1G65870 172 / 6e-55 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT3G13662 159 / 8e-50 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G49030 167 / 5e-48 OVA2 ovule abortion 2, tRNA synthetase class I (I, L, M and V) family protein (.1), tRNA synthetase class I (I, L, M and V) family protein (.2), tRNA synthetase class I (I, L, M and V) family protein (.3) AT2G21100 152 / 5e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42500 149 / 1e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1) AT5G42510 149 / 1e-45 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042488 [exp] 384 / 2e-138 AT1G58170 202 / 1e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10029306 [exp] 211 / 9e-70 AT1G65870 208 / 5e-69 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10030483 [exp] 197 / 1e-64 AT1G65870 164 / 1e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10017231 [exp] 190 / 9e-62 AT1G58170 191 / 2e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10021084 [exp] 166 / 5e-52 AT5G42500 164 / 2e-51 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10039561 [exp] 161 / 3e-50 AT3G13650 157 / 5e-49 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10034479 [exp] 154 / 1e-47 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10025065 [exp] 155 / 2e-47 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Lus10016237 [exp] 151 / 3e-47 AT1G58170 149 / 6e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G216400 [exp] 256 / 2e-87 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216300 [exp] 246 / 1e-83 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G061000 [exp] 221 / 5e-74 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G009100 [exp] 221 / 7e-74 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.006G195300 [exp] 204 / 2e-67 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.003G216200 [exp] 204 / 3e-67 AT1G55210 239 / 2e-81 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2) Potri.016G060900 [exp] 203 / 7e-67 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.016G060700 [exp] 200 / 1e-65 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.009G131000 [exp] 180 / 8e-58 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1) Potri.001G023800 [exp] 172 / 6e-55 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0650 [flax] [poplar] AOC_barrel PF03018 [flax] [poplar] Dirigent Dirigent-like protein
Representative CDS sequence Show only first row Show all	>Lus10026176 pacid=23156559 polypeptide=Lus10026176 locus=Lus10026176.g ID=Lus10026176.BGIv1.0 annot-version=v1.0 ATGGCGAAATATCTTCCACTCACTAGCTACCTAATTTCCACCCTAATCTTCTTGTCATCCCTTCAAAACACTTGCTCCCAAGAATTCGTAACACGCCTAA CCCGCAGGCAACTGGGCATGATGAAAAAGGAAAAAATAAGCCACTTCAAGTTCTACTGGCACGACATCTACAGCGCCCCCAACCCGACAGCCATGCCCAT AATCCAGCCCCCGCCTTCATCGGCTGCGACCGGGTTCGGATCCGTGTCGATGATCGACGACCCGATCACGATGGGCCCGGATCTGAAGACGTCGAAGCTG GTGGGCAGGGCCCAGGGGCTGTACGGAGTGGCTTCGCAGCAGGAGGTGGCGCTGCTGATGGTGATGAACTTCTGGTTCGTGGAAGGGAAGTACAACGGGA GTTCGATCACGATTCTGGGAAGGAACCCGGTGTTTGACAAAGTGAGGGAGATGCCCATAATTGGAGGGAGTGGGTTGTTCAGATTCGCCAGGGGATATGC TCATGCTTCCACTCATAACTTCAACATTTCCTCCGGGGATGCTTGTATTGAGTACAATCTCTACGTCATGCATTATTAA
AA sequence Show only first row Show all	>Lus10026176 pacid=23156559 polypeptide=Lus10026176 locus=Lus10026176.g ID=Lus10026176.BGIv1.0 annot-version=v1.0 MAKYLPLTSYLISTLIFLSSLQNTCSQEFVTRLTRRQLGMMKKEKISHFKFYWHDIYSAPNPTAMPIIQPPPSSAATGFGSVSMIDDPITMGPDLKTSKL VGRAQGLYGVASQQEVALLMVMNFWFVEGKYNGSSITILGRNPVFDKVREMPIIGGSGLFRFARGYAHASTHNFNISSGDACIEYNLYVMHY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G58170			Disease resistance-responsive ...		Lus10026176 [exp]	0	1
AT4G35040	bZIP	bZIP19	Basic-leucine zipper (bZIP) tr...		Lus10005073 [exp]	2.4	0.8722
AT3G22550			Protein of unknown function (D...		Lus10006102 [exp]	3.5	0.8361
AT2G16920		UBC23 ,PFU2	PHO2 FAMILY UBIQUITIN CONJUGAT...		Lus10037778 [exp]	4.9	0.8100
AT1G67330			Protein of unknown function (D...		Lus10006415 [exp]	6.9	0.8480
AT1G64450			Glycine-rich protein family (....		Lus10001818 [exp]	8.1	0.8019
AT5G47890			NADH-ubiquinone oxidoreductase...		Lus10011053 [exp]	9.4	0.8129
AT4G18700		ATWL4, CIPK12, ...	SNF1-RELATED PROTEIN KINASE 3....		Lus10015275 [exp]	9.5	0.8449
AT2G31200		ADF6, ATADF6	actin depolymerizing factor 6 ...		Lus10022933 [exp]	12.6	0.8330
AT2G16770	bZIP	bZIP23	Basic-leucine zipper (bZIP) tr...		Lus10027847 [exp]	13.0	0.8269
AT1G66150		TMK1	transmembrane kinase 1 (.1)		Lus10035105 [exp]	13.6	0.8100

Compare expression of checked genes

Lus10026176 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.