Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14620 153 / 2e-45 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT3G14660 148 / 2e-43 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT3G14690 146 / 8e-43 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14610 146 / 1e-42 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14680 144 / 5e-42 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14650 142 / 3e-41 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14630 140 / 2e-40 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT3G14640 136 / 5e-39 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT1G17060 107 / 1e-28 SHK1, CHI2, SOB7, CYP72C1 SUPPRESSOR OF PHYB-4 7, SHRINK 1, CHIBI 2, cytochrome p450 72c1 (.1) AT2G26710 105 / 1e-27 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042486 [exp] 207 / 9e-66 AT3G14690 580 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10042487 [exp] 176 / 7e-54 AT3G14690 604 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10026178 [exp] 172 / 2e-52 AT3G14690 607 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10017775 [exp] 120 / 7e-33 AT3G14630 359 / 2e-117 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10017771 [exp] 117 / 5e-32 AT2G26710 705 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10002311 [exp] 116 / 7e-32 AT3G14630 317 / 8e-104 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Lus10026084 [exp] 116 / 1e-31 AT2G26710 375 / 6e-125 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10033044 [exp] 115 / 5e-31 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10026085 [exp] 114 / 9e-31 AT2G46960 375 / 6e-125 "cytochrome P450, family 709, subfamily B, polypeptide 1", cytochrome P450, family 709, subfamily B, polypeptide 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G099701 [exp] 144 / 9e-46 AT3G14630 189 / 5e-59 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) Potri.011G101750 [exp] 143 / 2e-45 AT3G14680 194 / 6e-61 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) Potri.011G098800 [exp] 147 / 4e-43 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099400 [exp] 147 / 5e-43 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101401 [exp] 147 / 5e-43 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099800 [exp] 147 / 5e-43 AT3G14690 612 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101500 [exp] 145 / 2e-42 AT3G14690 609 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101700 [exp] 144 / 4e-42 AT3G14690 606 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099200 [exp] 141 / 5e-42 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G117600 [exp] 136 / 5e-39 AT3G14620 479 / 7e-166 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10026179 pacid=23156569 polypeptide=Lus10026179 locus=Lus10026179.g ID=Lus10026179.BGIv1.0 annot-version=v1.0 ATGTTACTTTGCCGTCAGGGGTTCACATTATTCTGCCCCACAGTCCTCATTCACACGGATCCTGAAATTTGGGGAAAAGATGCTGACGAGTTCAACCCGA AAAGATTCTCAGAAGGATTTTTTCAAGCCACGAAGAATCAACAAGTGGCCTACTATCCATTTGGATGGGGACCAAGAATATGCAGTGGCCAGAACTTTGC TCTTTTAGAGATAAAGATGGCTTTGGTGATCATTTTGAGGAGGTTTTCATTCGAGCTTTCATCATCCTATCTTCATGCTCCATCCACGGAAGCCATAACC CTTCATCCGCAATTTGGTGCTCCACTCATCATTCACAAACTTCAGAACTAA
AA sequence Show only first row Show all	>Lus10026179 pacid=23156569 polypeptide=Lus10026179 locus=Lus10026179.g ID=Lus10026179.BGIv1.0 annot-version=v1.0 MLLCRQGFTLFCPTVLIHTDPEIWGKDADEFNPKRFSEGFFQATKNQQVAYYPFGWGPRICSGQNFALLEIKMALVIILRRFSFELSSSYLHAPSTEAIT LHPQFGAPLIIHKLQN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14620		CYP72A8	"cytochrome P450, family 72, s...		Lus10026179 [exp]	0	1
AT5G03100			F-box/RNI-like superfamily pro...		Lus10029952 [exp]	1.7	0.9128
AT3G23350			ENTH/VHS family protein (.1)		Lus10021173 [exp]	5.8	0.9111
AT3G13890	MYB	ATMYB26, MS35	MALE STERILE 35, myb domain pr...		Lus10015608 [exp]	6.5	0.8941
AT1G20330		FRL1, CVP1, SMT...	FRILL1, COTYLEDON VASCULAR PAT...		Lus10004158 [exp]	7.1	0.9111
AT3G05550			Hypoxia-responsive family prot...		Lus10031490 [exp]	8.2	0.9111
AT5G60440	MADS	AGL62	AGAMOUS-like 62 (.1)		Lus10020511 [exp]	8.5	0.8737
AT2G14540		ATSRP2	serpin 2 (.1)		Lus10009905 [exp]	8.5	0.7947
					Lus10000984 [exp]	9.2	0.9111
					Lus10040014 [exp]	10.1	0.9111
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10012720 [exp]	10.7	0.7965

Compare expression of checked genes

Lus10026179 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.