Lus10026188 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G14570 86 / 2e-19 ATGSL4, ATGSL04 glucan synthase-like 4 (.1.2)
AT5G13000 78 / 1e-16 CALS3, ATGSL12 callose synthase 3, glucan synthase-like 12 (.1.2)
AT1G05570 73 / 1e-14 ATGSL6, ATGSL06, GSL6, CALS1 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2)
AT2G31960 70 / 9e-14 ATGSL3, ATGSL03 glucan synthase-like 3 (.1.2)
AT2G13680 68 / 5e-13 GLS2, ATGSL02, CALS5 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1)
AT3G59100 65 / 5e-12 ATGSL11 glucan synthase-like 11 (.1)
AT5G36870 62 / 5e-11 ATGSL9, ATGSL09 glucan synthase-like 9 (.1)
AT1G06490 60 / 2e-10 CalS7, ATGSL7, ATGSL07 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
AT4G03550 57 / 3e-09 ATGSL5, PMR4, GSL5, ATGSL05 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
AT3G07160 50 / 5e-07 CALS9, ATGSL10 glucan synthase-like 10 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042478 138 / 3e-37 AT3G14570 2889 / 0.0 glucan synthase-like 4 (.1.2)
Lus10013744 77 / 4e-16 AT1G05570 2981 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2)
Lus10039199 77 / 4e-16 AT5G13000 3524 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Lus10037469 75 / 3e-15 AT1G05570 3143 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2)
Lus10003920 75 / 3e-15 AT1G05570 3231 / 0.0 GLUCAN SYNTHASE-LIKE 6, callose synthase 1 (.1.2)
Lus10020750 64 / 1e-11 AT1G06490 2003 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
Lus10007327 64 / 1e-11 AT1G06490 1448 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
Lus10020893 63 / 2e-11 AT2G13680 3037 / 0.0 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1)
Lus10001056 62 / 8e-11 AT1G06490 1596 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G095100 99 / 1e-23 AT3G14570 2863 / 0.0 glucan synthase-like 4 (.1.2)
Potri.001G230000 78 / 1e-16 AT5G13000 3157 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Potri.003G214200 78 / 1e-16 AT5G13000 3363 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Potri.001G012200 77 / 3e-16 AT5G13000 3492 / 0.0 callose synthase 3, glucan synthase-like 12 (.1.2)
Potri.005G058300 62 / 4e-11 AT2G13680 3190 / 0.0 ARABIDOPSIS THALIANA GLUCAN SYNTHASE-LIKE 2, callose synthase 5 (.1)
Potri.005G203500 61 / 7e-11 AT1G06490 2914 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
Potri.002G058700 59 / 4e-10 AT1G06490 2961 / 0.0 callose synthase 7, Arabidopsis thaliana glucan synthase-like 7, glucan synthase-like 7 (.1)
Potri.013G131300 56 / 5e-09 AT4G03550 2752 / 0.0 POWDERY MILDEW RESISTANT 4, glucan synthase-like 5 (.1)
Potri.011G052400 49 / 1e-06 AT4G04970 2583 / 0.0 GLUCAN SYNTHASE LIKE-1, GLUCAN SYNTHASE LIKE 1, glucan synthase-like 1 (.1)
Potri.001G011900 42 / 0.0002 AT3G07160 2981 / 0.0 glucan synthase-like 10 (.1)
PFAM info
Representative CDS sequence
>Lus10026188 pacid=23156515 polypeptide=Lus10026188 locus=Lus10026188.g ID=Lus10026188.BGIv1.0 annot-version=v1.0
ATGGAAGCTGGTCTGGATAGTCCTTACATGGTTGCTGTTGCAATCTACATGACAACTAATGGAGTTGAGATGGTGTTATTTGTTGTTCCTGCTGTACGAA
AGTTCATTGAGATCTCAAATTGTCAGATTCAGAACTTTCTCTTGGTGGACACAGGTAAAGTTGGGCATAAAGGAGACCACAGACAAAAACAGCAACCAAG
ATTATATGCTGGTCGTGGGATGCAAGAAACCCAGGTTTCTGTTTTCAAGTACATTACTTTTCCTGCCATACCTTTCACTTTGATTTGTTTGCCTTCCCAG
TTTGAGTTTGCGAAATCTAAAAGTTGTTTTGTGCAGGGATTTGAAAGTGGAACAAGGACAAGAGCTGGCAGTCATGGTGGAACGACGAACAAACCCATCT
CCGGCGAGCAGGGGTTGGGGATAGACTTGGCTGTGGACATGGGAAGGCAACTGTTCAGTGCAAAATACCATTTGGGATTCAGGCTTTTCAAGACATTCCT
CTTTATTGCAGTTGTGGCCATCATAGTAACTCTATCACTAGCTGACAAGCTTTCGTTGAGGGATTTGATCGTCTGCTGTCTGGCATTTCTGCCAACAGGA
TGGGGACTTCTATTGATAGCACAAGCAGTGAGGCCGAAGATAGAGTAA
AA sequence
>Lus10026188 pacid=23156515 polypeptide=Lus10026188 locus=Lus10026188.g ID=Lus10026188.BGIv1.0 annot-version=v1.0
MEAGLDSPYMVAVAIYMTTNGVEMVLFVVPAVRKFIEISNCQIQNFLLVDTGKVGHKGDHRQKQQPRLYAGRGMQETQVSVFKYITFPAIPFTLICLPSQ
FEFAKSKSCFVQGFESGTRTRAGSHGGTTNKPISGEQGLGIDLAVDMGRQLFSAKYHLGFRLFKTFLFIAVVAIIVTLSLADKLSLRDLIVCCLAFLPTG
WGLLLIAQAVRPKIE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G14570 ATGSL4, ATGSL04 glucan synthase-like 4 (.1.2) Lus10026188 0 1
AT3G55500 ATHEXPALPHA1.7,... EXPANSIN 16, expansin A16 (.1) Lus10014406 2.4 0.9832
AT2G13600 Pentatricopeptide repeat (PPR)... Lus10026811 2.4 0.9812
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Lus10028306 4.2 0.9663
Lus10008289 4.9 0.9676
AT5G15630 IRX6, COBL4 IRREGULAR XYLEM 6, COBRA-LIKE4... Lus10021142 5.5 0.9694
Lus10036765 6.3 0.9694
Lus10006395 7.1 0.9694
AT1G54870 NAD(P)-binding Rossmann-fold s... Lus10034047 7.5 0.9258
AT2G16190 unknown protein Lus10011284 7.7 0.9694
AT3G54200 Late embryogenesis abundant (L... Lus10031554 8.4 0.9694

Lus10026188 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.