Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28950 44 / 3e-06 ATRAC7, ARAC7, ATROP9, ROP9 Arabidopsis RAC-like 7, RHO-related protein from plants 9 (.1) AT1G20090 42 / 1e-05 ROP2, ARAC4, ATROP2, ATRAC4 Arabidopsis RAC-like 4, RHO-related protein from plants 2 (.1) AT1G75840 40 / 7e-05 ATROP4, ATGP3, AT1G75840.1, ARAC5 RHO-LIKE GTP BINDING PROTEIN 4, ARABIDOPSIS THALIANA GERANYLGERANYLATED PROTEIN 3, RAC-like GTP binding protein 5 (.1) AT3G51290 39 / 0.0002 Protein of unknown function (DUF630) ;Protein of unknown function (DUF632) (.1), Protein of unknown function (DUF630) ;Protein of unknown function (DUF632) (.2) AT3G48040 39 / 0.0002 ROP10, ARAC8, ATROP10, ATRAC8 Arabidopsis RAC-like 8, RHO-related protein from plants 10 (.1) AT4G35020 39 / 0.0002 ROP6, ARAC3, RHO1PS, ATROP6 RHO-RELATED PROTEIN FROM PLANTS 6, RAC-like 3 (.1.2.3) AT3G51300 38 / 0.0002 ATRAC11, ROP1, ARAC11, ROP1AT, AtROP1 ARABIDOPSIS THALIANA RHO-RELATED PROTEIN FROM PLANTS 1, Arabidopsis RAC-like 11, RHO-related protein from plants 1 (.1) AT2G17800 36 / 0.001 ARAC1, ATGP2, ATRAC1, ROP3, AtROP3 RHO-RELATED GTPASES FROM PLANTS 3, Arabidopsis RAC-like 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002181 [exp] 52 / 2e-09 AT4G35020 320 / 8e-113 RHO-RELATED PROTEIN FROM PLANTS 6, RAC-like 3 (.1.2.3) Lus10039899 [exp] 52 / 3e-09 AT4G35020 324 / 1e-114 RHO-RELATED PROTEIN FROM PLANTS 6, RAC-like 3 (.1.2.3) Lus10034932 [exp] 47 / 2e-07 AT4G28950 362 / 1e-129 Arabidopsis RAC-like 7, RHO-related protein from plants 9 (.1) Lus10023660 [exp] 45 / 1e-06 AT4G28950 367 / 2e-131 Arabidopsis RAC-like 7, RHO-related protein from plants 9 (.1) Lus10033131 [exp] 38 / 0.0004 AT4G35020 361 / 4e-129 RHO-RELATED PROTEIN FROM PLANTS 6, RAC-like 3 (.1.2.3) Lus10017271 [exp] 37 / 0.0007 AT1G27940 1689 / 0.0 ATP-binding cassette B13, P-glycoprotein 13 (.1) Lus10025959 [exp] 37 / 0.0007 AT2G17800 355 / 2e-126 RHO-RELATED GTPASES FROM PLANTS 3, Arabidopsis RAC-like 1 (.1.2) Lus10014123 [exp] 37 / 0.0008 AT4G35020 354 / 5e-126 RHO-RELATED PROTEIN FROM PLANTS 6, RAC-like 3 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G083400 [exp] 45 / 1e-06 AT4G28950 393 / 2e-141 Arabidopsis RAC-like 7, RHO-related protein from plants 9 (.1) Potri.013G123800 [exp] 43 / 5e-06 AT1G75840 342 / 1e-121 RHO-LIKE GTP BINDING PROTEIN 4, ARABIDOPSIS THALIANA GERANYLGERANYLATED PROTEIN 3, RAC-like GTP binding protein 5 (.1) Potri.015G073000 [exp] 41 / 3e-05 AT5G62880 354 / 7e-126 RHO-RELATED PROTEIN FROM PLANTS 11, ARABIDOPSIS THALIANA RAC-LIKE 10, RAC-like 10 (.1) Potri.019G092300 [exp] 40 / 4e-05 AT1G75840 337 / 9e-120 RHO-LIKE GTP BINDING PROTEIN 4, ARABIDOPSIS THALIANA GERANYLGERANYLATED PROTEIN 3, RAC-like GTP binding protein 5 (.1) Potri.004G174900 [exp] 40 / 5e-05 AT4G35020 360 / 8e-129 RHO-RELATED PROTEIN FROM PLANTS 6, RAC-like 3 (.1.2.3) Potri.002G019500 [exp] 39 / 9e-05 AT1G75840 352 / 1e-125 RHO-LIKE GTP BINDING PROTEIN 4, ARABIDOPSIS THALIANA GERANYLGERANYLATED PROTEIN 3, RAC-like GTP binding protein 5 (.1) Potri.012G077800 [exp] 39 / 9e-05 AT5G62880 359 / 6e-128 RHO-RELATED PROTEIN FROM PLANTS 11, ARABIDOPSIS THALIANA RAC-LIKE 10, RAC-like 10 (.1) Potri.011G061500 [exp] 39 / 0.0001 AT5G45970 344 / 1e-122 RHO-RELATED PROTEIN FROM PLANTS 7, ARABIDOPSIS THALIANA RAC 2, Arabidopsis RAC-like 2, RAC-like 2 (.1) Potri.009G134600 [exp] 39 / 0.0002 AT1G75840 353 / 5e-126 RHO-LIKE GTP BINDING PROTEIN 4, ARABIDOPSIS THALIANA GERANYLGERANYLATED PROTEIN 3, RAC-like GTP binding protein 5 (.1) Potri.014G051800 [exp] 38 / 0.0003 AT4G35020 324 / 3e-114 RHO-RELATED PROTEIN FROM PLANTS 6, RAC-like 3 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10026189 pacid=23156413 polypeptide=Lus10026189 locus=Lus10026189.g ID=Lus10026189.BGIv1.0 annot-version=v1.0 ATGGAAGAAGGCGGAGGAGGACTACTCGGATCCGCTGCCGCAGACCCCGGTTCATCTAACGGAGAAGAAGATGAAGACGACGGAAGCAAAAAGAGGAAAC TGAATTCGGACAAACTTTGTCGTGGGGAGAAGAACTTGAAGAAGAAGGTAAGTGTTGCAGTGTACATAGAATACAGGTCCAACACTCAACACGACATGAA AGTAGTGTTTGATACTGCAATCAAGGTTGTTCTGCAGCCTCCCAAACAAAAGAAGCAAGGACTCGAGAATAATGGATTGTAA
AA sequence Show only first row Show all	>Lus10026189 pacid=23156413 polypeptide=Lus10026189 locus=Lus10026189.g ID=Lus10026189.BGIv1.0 annot-version=v1.0 MEEGGGGLLGSAAADPGSSNGEEDEDDGSKKRKLNSDKLCRGEKNLKKKVSVAVYIEYRSNTQHDMKVVFDTAIKVVLQPPKQKKQGLENNGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28950		ATRAC7, ARAC7, ...	Arabidopsis RAC-like 7, RHO-re...		Lus10026189 [exp]	0	1
AT5G15940			NAD(P)-binding Rossmann-fold s...		Lus10016771 [exp]	1.7	0.8402
AT4G20380		LSD1	LESION SIMULATING DISEASE, LSD...		Lus10000782 [exp]	3.7	0.8091
AT3G25570			Adenosylmethionine decarboxyla...		Lus10034412 [exp]	6.3	0.7801
AT1G08860		BON3	BONZAI 3, Calcium-dependent ph...		Lus10033826 [exp]	7.1	0.7783
AT5G63050		EMB2759	embryo defective 2759 (.1.2)		Lus10001245 [exp]	8.5	0.7661
AT1G69550			disease resistance protein (TI...		Lus10018308 [exp]	9.4	0.7686
AT1G68310		AE7	AS1/2 ENHANCER7, Protein of un...		Lus10035404 [exp]	11.5	0.7708
AT2G38110		ATGPAT6, GPAT6	glycerol-3-phosphate acyltrans...		Lus10004833 [exp]	14.0	0.7399
AT1G34570			Essential protein Yae1, N-term...		Lus10019775 [exp]	14.5	0.6699
AT5G49150		GEX2, ATGEX2	gamete expressed 2 (.1)		Lus10027014 [exp]	17.1	0.6523

Compare expression of checked genes

Lus10026189 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.